| Clone Name | rbags31a07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | SYP61_ARATH (Q946Y7) Syntaxin-61 (AtSYP61) (Osmotic stress-sensi... | 40 | 0.001 | 2 | FAF1_YEAST (P40546) Protein FAF1 (Forty S assembly factor) | 31 | 0.76 | 3 | RPOD_BUCAI (P57163) RNA polymerase sigma factor rpoD (Sigma-70) | 28 | 8.4 | 4 | RN113_CAEEL (O17917) Putative RING finger protein 113 homolog | 28 | 8.4 |
|---|
>SYP61_ARATH (Q946Y7) Syntaxin-61 (AtSYP61) (Osmotic stress-sensitive mutant 1)| Length = 245 Score = 40.4 bits (93), Expect = 0.001 Identities = 18/30 (60%), Positives = 24/30 (80%) Frame = -2 Query: 223 ETTSYRLDFXQKRVAMVLKKASLKGQIMMI 134 ++T RL+F QK+V MV+KKA KGQ+MMI Sbjct: 199 DSTKNRLEFVQKKVGMVMKKAGAKGQMMMI 228
>FAF1_YEAST (P40546) Protein FAF1 (Forty S assembly factor)| Length = 346 Score = 31.2 bits (69), Expect = 0.76 Identities = 18/48 (37%), Positives = 25/48 (52%) Frame = +2 Query: 35 LYTSWQILTQLKLHLSSQEYQNEKDDEKNHQESYHHDLPFQAGLL*NH 178 L S + LTQ+ L S E + EK+DE E+ +DL Q L +H Sbjct: 116 LLRSGKTLTQINKKLESTEAKEEKEDETLEAENLQNDLELQQFLRESH 163
>RPOD_BUCAI (P57163) RNA polymerase sigma factor rpoD (Sigma-70)| Length = 612 Score = 27.7 bits (60), Expect = 8.4 Identities = 12/35 (34%), Positives = 21/35 (60%), Gaps = 3/35 (8%) Frame = +2 Query: 50 QILTQLKLHLSSQ---EYQNEKDDEKNHQESYHHD 145 +I +H+ S+ E QN ++DE+N+QE + D Sbjct: 174 EIFPPTAIHIGSELLDEQQNNEEDEENNQEDHEDD 208
>RN113_CAEEL (O17917) Putative RING finger protein 113 homolog| Length = 384 Score = 27.7 bits (60), Expect = 8.4 Identities = 16/48 (33%), Positives = 26/48 (54%), Gaps = 10/48 (20%) Frame = +2 Query: 32 VLYTSWQILTQLKLHLSSQEYQNEK--------DDEKNHQ--ESYHHD 145 ++ T+ ++LT LK Q+ + EK DDEK H+ + +HHD Sbjct: 285 IMNTAKELLTYLKRKKQQQKQEAEKQEEEKDSDDDEKPHECDDHHHHD 332 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 24,601,191 Number of Sequences: 219361 Number of extensions: 332137 Number of successful extensions: 1114 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1081 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1114 length of database: 80,573,946 effective HSP length: 50 effective length of database: 69,605,896 effective search space used: 1670541504 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)