| Clone Name | rbaal1l09 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | Y978_MYCBO (P64770) Hypothetical protein Mb0978c | 29 | 3.2 | 2 | Y953_MYCTU (P64769) Hypothetical protein Rv0953c/MT0980 | 29 | 3.2 | 3 | PURA_ZYMMO (Q5NLU9) Adenylosuccinate synthetase (EC 6.3.4.4) (IM... | 28 | 7.1 | 4 | IRS1_HUMAN (P35568) Insulin receptor substrate 1 (IRS-1) | 28 | 7.1 | 5 | IRS1_CERAE (Q28224) Insulin receptor substrate 1 (IRS-1) | 28 | 7.1 |
|---|
>Y978_MYCBO (P64770) Hypothetical protein Mb0978c| Length = 282 Score = 28.9 bits (63), Expect = 3.2 Identities = 15/35 (42%), Positives = 18/35 (51%) Frame = -1 Query: 365 PAHRHRPMAR**IHPPINIARLICDRYMHGNNPFV 261 P H H P+ R HP A L DRYM +P+V Sbjct: 34 PEHTHIPVKRQAAHPTTGDASLPDDRYMRTLDPWV 68
>Y953_MYCTU (P64769) Hypothetical protein Rv0953c/MT0980| Length = 282 Score = 28.9 bits (63), Expect = 3.2 Identities = 15/35 (42%), Positives = 18/35 (51%) Frame = -1 Query: 365 PAHRHRPMAR**IHPPINIARLICDRYMHGNNPFV 261 P H H P+ R HP A L DRYM +P+V Sbjct: 34 PEHTHIPVKRQAAHPTTGDASLPDDRYMRTLDPWV 68
>PURA_ZYMMO (Q5NLU9) Adenylosuccinate synthetase (EC 6.3.4.4) (IMP--aspartate| ligase) (AdSS) (AMPSase) Length = 429 Score = 27.7 bits (60), Expect = 7.1 Identities = 19/45 (42%), Positives = 25/45 (55%), Gaps = 7/45 (15%) Frame = -2 Query: 358 IVIDPWHGDEFTHRL------ILPD*SAI-DTCMVIIRLSSCMDG 245 +VIDPWH + RL I PD AI +T +I+ L S +DG Sbjct: 71 VVIDPWHFRDEMERLRKQDVVITPDTLAIAETSPLILPLHSELDG 115
>IRS1_HUMAN (P35568) Insulin receptor substrate 1 (IRS-1)| Length = 1242 Score = 27.7 bits (60), Expect = 7.1 Identities = 13/22 (59%), Positives = 16/22 (72%) Frame = -1 Query: 362 AHRHRPMAR**IHPPINIARLI 297 AHRHR AR +HPP+N +R I Sbjct: 356 AHRHRGSAR--LHPPLNHSRSI 375
>IRS1_CERAE (Q28224) Insulin receptor substrate 1 (IRS-1)| Length = 1251 Score = 27.7 bits (60), Expect = 7.1 Identities = 13/22 (59%), Positives = 16/22 (72%) Frame = -1 Query: 362 AHRHRPMAR**IHPPINIARLI 297 AHRHR AR +HPP+N +R I Sbjct: 356 AHRHRGSAR--LHPPLNHSRSI 375 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 50,479,414 Number of Sequences: 219361 Number of extensions: 885106 Number of successful extensions: 1572 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1552 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1572 length of database: 80,573,946 effective HSP length: 98 effective length of database: 59,076,568 effective search space used: 1417837632 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)