| Clone Name | rbags30j17 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | UBR2_HUMAN (Q8IWV8) Ubiquitin-protein ligase E3 component N-reco... | 30 | 4.6 | 2 | PGLRX_ASPTU (Q00293) Exopolygalacturonase precursor (EC 3.2.1.67... | 30 | 6.1 | 3 | RGA7_SCHPO (O94466) Probable Rho-GTPase-activating protein 7 | 29 | 7.9 |
|---|
>UBR2_HUMAN (Q8IWV8) Ubiquitin-protein ligase E3 component N-recognin-2 (EC| 6.-.-.-) (Ubiquitin-protein ligase E3-alpha-2) (Ubiquitin-protein ligase E3-alpha-II) Length = 1755 Score = 30.0 bits (66), Expect = 4.6 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = -2 Query: 429 GEQQNPNGDRGGHLGN*MLSNKLLWLKLRPVYHE 328 G Q+ P+G+ + MLS+ LW R VYH+ Sbjct: 339 GLQEGPDGENSSLVDRLMLSDSKLWKGARSVYHQ 372
>PGLRX_ASPTU (Q00293) Exopolygalacturonase precursor (EC 3.2.1.67) (ExoPG)| (Galacturan 1,4-alpha-galacturonidase) (Poly(1,4-alpha-D-galacturonide)galacturonohydrolase) Length = 435 Score = 29.6 bits (65), Expect = 6.1 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +3 Query: 270 SPLLFSHLNITKPTRFNHLVRDTLDEALAIITCLIAS 380 S + S++N+T P N V D +DE+L + C S Sbjct: 398 SDIYTSNINVTSPDGTNDFVCDNVDESLLSVNCTATS 434
>RGA7_SCHPO (O94466) Probable Rho-GTPase-activating protein 7| Length = 695 Score = 29.3 bits (64), Expect = 7.9 Identities = 14/31 (45%), Positives = 20/31 (64%) Frame = +3 Query: 9 NPTNK*EYSNRTPIQNQSPSPSTTHNQSTSS 101 NPT K + +P+QN +P+PST N S +S Sbjct: 354 NPTIKVTAAIPSPLQNTNPAPSTFPNPSVAS 384 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 74,627,307 Number of Sequences: 219361 Number of extensions: 1373444 Number of successful extensions: 3626 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3489 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3618 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4585734400 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)