| Clone Name | rbaal1l04 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | HOT13_YEAST (P36078) Helper of Tim protein 13 | 29 | 2.6 | 2 | LERL1_PONPY (Q5RDE9) Leptin receptor overlapping transcript-like 1 | 29 | 3.4 | 3 | LERL1_MOUSE (Q9CQ74) Leptin receptor overlapping transcript-like 1 | 29 | 3.4 | 4 | LERL1_HUMAN (O95214) Leptin receptor overlapping transcript-like 1 | 29 | 3.4 |
|---|
>HOT13_YEAST (P36078) Helper of Tim protein 13| Length = 116 Score = 29.3 bits (64), Expect = 2.6 Identities = 19/51 (37%), Positives = 24/51 (47%), Gaps = 7/51 (13%) Frame = -1 Query: 268 CGVCRHAELLCAHFGXYKLNLDLASEASKXPVPSGC-------FQLPPKAL 137 CGVCRH E+ A + Y N +L + P GC FQ PP A+ Sbjct: 68 CGVCRH-EMTFAEY--YDYNSNLICPNCRSPFNPGCKLHYHLYFQNPPPAM 115
>LERL1_PONPY (Q5RDE9) Leptin receptor overlapping transcript-like 1| Length = 131 Score = 28.9 bits (63), Expect = 3.4 Identities = 14/33 (42%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Frame = -1 Query: 136 GYKSIID*SYFGPLGHTVLLY-CCLPACNFYWP 41 G K++I S+ G +G L+ C LP N YWP Sbjct: 3 GIKALISLSFGGAIGLMFLMLGCALPIYNKYWP 35
>LERL1_MOUSE (Q9CQ74) Leptin receptor overlapping transcript-like 1| Length = 131 Score = 28.9 bits (63), Expect = 3.4 Identities = 14/33 (42%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Frame = -1 Query: 136 GYKSIID*SYFGPLGHTVLLY-CCLPACNFYWP 41 G K++I S+ G +G L+ C LP N YWP Sbjct: 3 GIKALISLSFGGAIGLMFLMLGCALPIYNQYWP 35
>LERL1_HUMAN (O95214) Leptin receptor overlapping transcript-like 1| Length = 131 Score = 28.9 bits (63), Expect = 3.4 Identities = 14/33 (42%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Frame = -1 Query: 136 GYKSIID*SYFGPLGHTVLLY-CCLPACNFYWP 41 G K++I S+ G +G L+ C LP N YWP Sbjct: 3 GIKALISLSFGGAIGLMFLMLGCALPIYNKYWP 35 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 45,362,567 Number of Sequences: 219361 Number of extensions: 823860 Number of successful extensions: 1972 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1757 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1972 length of database: 80,573,946 effective HSP length: 78 effective length of database: 63,463,788 effective search space used: 1523130912 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)