| Clone Name | rbags30e19 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | COTR_CAVPO (P22323) Serine proteinase inhibitor A3K precursor (C... | 30 | 4.7 |
|---|
>COTR_CAVPO (P22323) Serine proteinase inhibitor A3K precursor (Contrapsin)| (CP) (Serpin A3K) Length = 410 Score = 30.4 bits (67), Expect = 4.7 Identities = 14/40 (35%), Positives = 26/40 (65%), Gaps = 1/40 (2%) Frame = -2 Query: 625 YSGDVGSTFMVQDEGRVK-VREALTPQAMQMALRRVISFP 509 Y G+V + F++ DEG+++ + E LTP+ + LR+ + P Sbjct: 260 YEGNVTALFLLPDEGKMQHLEETLTPELVFKFLRKTETMP 299 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 96,095,031 Number of Sequences: 219361 Number of extensions: 1925968 Number of successful extensions: 4567 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 4429 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4567 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6029593548 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)