| Clone Name | rbags30e01 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | MIH_JASLA (P83220) Probable molt-inhibiting hormone (MIH) | 30 | 1.7 | 2 | SMYD3_MOUSE (Q9CWR2) SET and MYND domain-containing protein 3 (E... | 29 | 4.9 | 3 | NOSZ_BRAJA (Q89XJ6) Nitrous-oxide reductase precursor (EC 1.7.99... | 28 | 8.3 |
|---|
>MIH_JASLA (P83220) Probable molt-inhibiting hormone (MIH)| Length = 74 Score = 30.4 bits (67), Expect = 1.7 Identities = 10/31 (32%), Positives = 18/31 (58%) Frame = -2 Query: 144 YIYRELELACMPCMHIYLELRVVMEVIEGCF 52 Y+Y ++E C C ++Y E ++ + E CF Sbjct: 14 YLYEQVEQVCDDCYNLYREEKIAVNCRENCF 44
>SMYD3_MOUSE (Q9CWR2) SET and MYND domain-containing protein 3 (EC 2.1.1.43)| (Zinc finger MYND domain-containing protein 1) Length = 428 Score = 28.9 bits (63), Expect = 4.9 Identities = 14/46 (30%), Positives = 23/46 (50%) Frame = -2 Query: 369 RRGWESTRESCSILQSGCAPRGPSAMKNLGGNICLALANDRVYEDD 232 ++ W R CS L+S C PR P L G + + L +++ E + Sbjct: 77 KKAWPDHRRECSCLKS-CKPRYPPDSVRLLGRVIVKLMDEKPSESE 121
>NOSZ_BRAJA (Q89XJ6) Nitrous-oxide reductase precursor (EC 1.7.99.6) (N(2)OR)| (N2O reductase) Length = 650 Score = 28.1 bits (61), Expect = 8.3 Identities = 12/29 (41%), Positives = 14/29 (48%) Frame = -2 Query: 363 GWESTRESCSILQSGCAPRGPSAMKNLGG 277 GW T ES +L G P +KN GG Sbjct: 111 GWGQTNESLKVLTEGMQPATREFLKNRGG 139 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 56,422,988 Number of Sequences: 219361 Number of extensions: 1092836 Number of successful extensions: 2521 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2452 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2521 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2169600302 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)