| Clone Name | rbags30d22 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | BYR4_SCHPO (Q10951) Protein byr4 | 30 | 6.1 | 2 | Y1137_PYRHO (O58864) Hypothetical RNA methyltransferase PH1137 (... | 30 | 8.0 |
|---|
>BYR4_SCHPO (Q10951) Protein byr4| Length = 665 Score = 30.0 bits (66), Expect = 6.1 Identities = 15/43 (34%), Positives = 26/43 (60%) Frame = -1 Query: 379 GAFENIVSGPEYAELREGGPKKLNIQFFKDIQARMRDPNFNFS 251 G+ +I++ P+ +E+ + GP+ QF +DIQ R R + FS Sbjct: 603 GSINSIINFPDMSEIYDVGPEFEKKQFSEDIQWRKRIDGWFFS 645
>Y1137_PYRHO (O58864) Hypothetical RNA methyltransferase PH1137 (EC 2.1.1.-)| Length = 407 Score = 29.6 bits (65), Expect = 8.0 Identities = 19/62 (30%), Positives = 29/62 (46%) Frame = -1 Query: 493 GKQARKLAVENALKKLKKGPDGRYINVFDVVTDIDILIGAFENIVSGPEYAELREGGPKK 314 G + + A+E A K K + VFDV TD ++ + F+ ++ P L KK Sbjct: 298 GFDSNEFAIEMARKNAKIN---KVDAVFDVATDREVEVNGFDTVIVDPPRVGLHPKLIKK 354 Query: 313 LN 308 LN Sbjct: 355 LN 356 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 79,490,019 Number of Sequences: 219361 Number of extensions: 1387681 Number of successful extensions: 3399 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3317 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3398 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6029593548 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)