| Clone Name | rbaal1k24 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | Y066_NPVAC (P41467) Hypothetical 94.0 kDa protein in POL-LEF3 in... | 29 | 6.9 | 2 | TSH2_MOUSE (Q68FE9) Teashirt homolog 2 (Zinc finger protein 218)... | 29 | 9.0 |
|---|
>Y066_NPVAC (P41467) Hypothetical 94.0 kDa protein in POL-LEF3 intergenic| region Length = 808 Score = 29.3 bits (64), Expect = 6.9 Identities = 18/52 (34%), Positives = 26/52 (50%) Frame = -2 Query: 413 PALTAPPCTNSTGTGRSMSTRYITLLRTHLQSTRSCLFKS*SDHLAAQQLQN 258 P T PP +N G G S S ITL +S + LFK+ ++ + +QN Sbjct: 136 PPPTQPPESNVAGVGGSQSLNQITLTNEE-ESELAALFKNMQTNMTWELVQN 186
>TSH2_MOUSE (Q68FE9) Teashirt homolog 2 (Zinc finger protein 218)| (SDCCAG33-like protein) Length = 1030 Score = 28.9 bits (63), Expect = 9.0 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = -1 Query: 336 TNPPTKYKVLSVQELVRSLSCPTTPKP 256 T+PP K+ + + ++V+ L TTPKP Sbjct: 780 TSPPQKHALCDIADMVKVLPKATTPKP 806 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 75,457,717 Number of Sequences: 219361 Number of extensions: 1491440 Number of successful extensions: 3682 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3591 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3682 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 3970331829 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)