| Clone Name | rbaal1k08 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | YMA2_YEAST (Q04263) Hypothetical 84.6 kDa protein in GLO1-YPT7 i... | 30 | 1.7 | 2 | Y677_TREPA (O83683) Hypothetical protein TP0677 | 28 | 4.9 | 3 | NU6M_DIDMA (P41315) NADH-ubiquinone oxidoreductase chain 6 (EC 1... | 28 | 4.9 | 4 | BACS2_NATPH (P42196) Sensory rhodopsin-2 (Sensory rhodopsin II) ... | 28 | 6.4 |
|---|
>YMA2_YEAST (Q04263) Hypothetical 84.6 kDa protein in GLO1-YPT7 intergenic| region Length = 737 Score = 30.0 bits (66), Expect = 1.7 Identities = 15/57 (26%), Positives = 28/57 (49%), Gaps = 2/57 (3%) Frame = +1 Query: 25 LHRCPDCF--LVDLRRSPRNFATDVACMRXELEVQXSYESNGHDGKDGKRDESPTDV 189 LH+ +CF L+ L++ P N TD A + + + S + GK+ + P ++ Sbjct: 462 LHQLTNCFNVLLFLKKIPENLFTDEASILYWMRINTSKRNQKPSGKENPKTMEPEEI 518
>Y677_TREPA (O83683) Hypothetical protein TP0677| Length = 202 Score = 28.5 bits (62), Expect = 4.9 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = +1 Query: 22 KLHRCPDCFLVDLRRSPRNFATDV 93 ++H C DC + +RR+ R FA DV Sbjct: 45 QVHACVDCGMRGIRRAVRRFAADV 68
>NU6M_DIDMA (P41315) NADH-ubiquinone oxidoreductase chain 6 (EC 1.6.5.3) (NADH| dehydrogenase subunit 6) Length = 168 Score = 28.5 bits (62), Expect = 4.9 Identities = 10/27 (37%), Positives = 19/27 (70%) Frame = -1 Query: 219 FVTISYLLLLXISWRFVSLAIFPVMAI 139 F+ + ++LLL + W F+S ++ +MAI Sbjct: 90 FIMLLFVLLLQVGWYFMSKLVYIIMAI 116
>BACS2_NATPH (P42196) Sensory rhodopsin-2 (Sensory rhodopsin II) (SR-II)| Length = 239 Score = 28.1 bits (61), Expect = 6.4 Identities = 12/34 (35%), Positives = 22/34 (64%) Frame = -1 Query: 162 AIFPVMAIAFIGALYFKLXPHTGDISRKVTGRSS 61 A+F + A+AF+G +Y+ + P T S++ +G S Sbjct: 125 ALFGMGAVAFLGLVYYLVGPMTESASQRSSGIKS 158 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 26,118,405 Number of Sequences: 219361 Number of extensions: 346809 Number of successful extensions: 1575 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1550 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1575 length of database: 80,573,946 effective HSP length: 50 effective length of database: 69,605,896 effective search space used: 1670541504 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)