| Clone Name | rbags29k22 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | DNAK_MYXXA (P95334) Chaperone protein dnaK (Heat shock protein 7... | 30 | 5.0 | 2 | YNAJ_BACSU (P94488) Hypothetical symporter ynaJ | 30 | 6.5 |
|---|
>DNAK_MYXXA (P95334) Chaperone protein dnaK (Heat shock protein 70) (Heat shock| 70 kDa protein) (HSP70) Length = 607 Score = 30.0 bits (66), Expect = 5.0 Identities = 17/63 (26%), Positives = 33/63 (52%), Gaps = 2/63 (3%) Frame = +3 Query: 111 NTSTLIPVFLTTVILDSQLHSADSKTQQRMAQDQNNTHA--YATDHK*QQRRSLTDHRTC 284 + S L + +I D+Q H++D K ++ +A+ +NN Y T+ ++ SL + Sbjct: 502 SNSGLSEAEIQAMISDAQSHASDDKKKKELAELRNNADGLIYTTEKSLEEYASLLSEKDR 561 Query: 285 DEI 293 +EI Sbjct: 562 EEI 564
>YNAJ_BACSU (P94488) Hypothetical symporter ynaJ| Length = 463 Score = 29.6 bits (65), Expect = 6.5 Identities = 14/44 (31%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = +3 Query: 114 TSTLIPVFLTTV-ILDSQLHSADSKTQQRMAQDQNNTHAYATDH 242 T+T+IPVFL + ++D ++ D K + M ++ N DH Sbjct: 414 TTTIIPVFLLVLALIDINFYNLDEKKYKNMVRELENRDKVYLDH 457 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 61,038,922 Number of Sequences: 219361 Number of extensions: 1016779 Number of successful extensions: 2605 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2543 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2604 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4929664480 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)