| Clone Name | rbags29j13 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | OGG1_RAT (O70249) N-glycosylase/DNA lyase [Includes: 8-oxoguanin... | 29 | 5.8 | 2 | OGG1_HUMAN (O15527) N-glycosylase/DNA lyase [Includes: 8-oxoguan... | 29 | 7.6 | 3 | BTUC_VIBVU (Q8D927) Vitamin B12 import system permease protein btuC | 28 | 9.9 | 4 | FBN2_HUMAN (P35556) Fibrillin-2 precursor | 28 | 9.9 |
|---|
>OGG1_RAT (O70249) N-glycosylase/DNA lyase [Includes: 8-oxoguanine DNA| glycosylase (EC 3.2.2.-); DNA-(apurinic or apyrimidinic site) lyase (EC 4.2.99.18) (AP lyase)] Length = 345 Score = 29.3 bits (64), Expect = 5.8 Identities = 15/45 (33%), Positives = 20/45 (44%) Frame = -2 Query: 407 RSTIEKPSIWAACPCPDKGLI*ESVLKRPSDLNRREMLSNIWSFV 273 R+ P++WA+ PCP L + VL RE WS V Sbjct: 14 RTLTSSPALWASIPCPRSELRLDLVLASGQSFRWREQSPAHWSGV 58
>OGG1_HUMAN (O15527) N-glycosylase/DNA lyase [Includes: 8-oxoguanine DNA| glycosylase (EC 3.2.2.-); DNA-(apurinic or apyrimidinic site) lyase (EC 4.2.99.18) (AP lyase)] Length = 345 Score = 28.9 bits (63), Expect = 7.6 Identities = 15/45 (33%), Positives = 20/45 (44%) Frame = -2 Query: 407 RSTIEKPSIWAACPCPDKGLI*ESVLKRPSDLNRREMLSNIWSFV 273 R+ P++WA+ PCP L + VL RE WS V Sbjct: 14 RTLASTPALWASIPCPRSELRLDLVLPSGQSFRWREQSPAHWSGV 58
>BTUC_VIBVU (Q8D927) Vitamin B12 import system permease protein btuC| Length = 331 Score = 28.5 bits (62), Expect = 9.9 Identities = 17/44 (38%), Positives = 25/44 (56%), Gaps = 4/44 (9%) Frame = +1 Query: 361 GQGHAAQMEGFSIVDLH----RLLICVSILISCV*PFGCCVSML 480 G+ HAAQ+ VD+H RL++ +SILI C G +S + Sbjct: 220 GETHAAQLG----VDVHKVRWRLILAISILIGCAVALGGIISFV 259
>FBN2_HUMAN (P35556) Fibrillin-2 precursor| Length = 2911 Score = 28.5 bits (62), Expect = 9.9 Identities = 20/55 (36%), Positives = 28/55 (50%), Gaps = 3/55 (5%) Frame = -3 Query: 448 HS*SESTHI*EACEDLQLRNLPSGLHAPAQ---TKASSEKVC*RGQVTSTEGKCC 293 H SE+T + CED+ ++ G+ + T S VC RG VTST+G C Sbjct: 306 HKQSETT---QKCEDIDECSIIPGICETGECSNTVGSYFCVCPRGYVTSTDGSRC 357 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 70,499,106 Number of Sequences: 219361 Number of extensions: 1441787 Number of successful extensions: 3144 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3062 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3144 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3362826254 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)