| Clone Name | rbags29i24 |
|---|---|
| Clone Library Name | barley_pub |
>PSD4_ARATH (P55034) 26S proteasome non-ATPase regulatory subunit 4 (26S| proteasome regulatory subunit S5A) (Multiubiquitin chain-binding protein) Length = 386 Score = 56.2 bits (134), Expect = 9e-08 Identities = 28/67 (41%), Positives = 50/67 (74%) Frame = -3 Query: 417 QDAEASGQSDMSKVFEDRSFVTSILNSLPGVDPNDPSVKDLLASLHGQGEQEKKDEADKT 238 + +EA+G + + +++F++S+L+SLPGVDPNDP+VK+LLASL + ++ +++E+ + Sbjct: 322 ESSEATGAGN--NLLGNQAFISSVLSSLPGVDPNDPAVKELLASLPDESKRTEEEES-SS 378 Query: 237 DKPEDGK 217 K ED K Sbjct: 379 KKGEDEK 385
>PSD4_HUMAN (P55036) 26S proteasome non-ATPase regulatory subunit 4 (26S| proteasome regulatory subunit S5A) (Rpn10) (Multiubiquitin chain-binding protein) (Antisecretory factor 1) (AF) (ASF) Length = 377 Score = 46.2 bits (108), Expect = 1e-04 Identities = 20/60 (33%), Positives = 37/60 (61%) Frame = -3 Query: 411 AEASGQSDMSKVFEDRSFVTSILNSLPGVDPNDPSVKDLLASLHGQGEQEKKDEADKTDK 232 +E + + D V +D F+ S+L +LPGVDPN+ ++++ + SL Q ++ K + + DK Sbjct: 317 SEPAKEEDDYDVMQDPEFLQSVLENLPGVDPNNEAIRNAMGSLASQATKDGKKDKKEEDK 376
>PSD4_MOUSE (O35226) 26S proteasome non-ATPase regulatory subunit 4 (26S| proteasome regulatory subunit S5A) (Rpn10) (Multiubiquitin chain-binding protein) Length = 376 Score = 43.5 bits (101), Expect = 6e-04 Identities = 20/56 (35%), Positives = 35/56 (62%), Gaps = 4/56 (7%) Frame = -3 Query: 396 QSDMSKVFEDRSFVTSILNSLPGVDPNDPSVKDLLASLHGQ----GEQEKKDEADK 241 + D V +D F+ S+L +LPGVDPN+ +++ ++ +L Q G+ +KK+E K Sbjct: 321 EEDDYDVMQDPEFLQSVLENLPGVDPNNAAIRSVMGALASQATKDGKNDKKEEEKK 376
>PSD4_DROME (P55035) 26S proteasome non-ATPase regulatory subunit 4 (26S| proteasome regulatory subunit S5A) (Multiubiquitin chain-binding protein) (54 kDa subunit of mu particle) (p54) Length = 396 Score = 42.0 bits (97), Expect = 0.002 Identities = 21/53 (39%), Positives = 33/53 (62%) Frame = -3 Query: 390 DMSKVFEDRSFVTSILNSLPGVDPNDPSVKDLLASLHGQGEQEKKDEADKTDK 232 D S+V D +F+ S+L +LPGVDP +V+D + SL+ + + +K D D K Sbjct: 345 DYSEVIGDPAFLQSVLENLPGVDPQSEAVRDAVGSLN-KDKDKKSDGKDSQKK 396
>PSD4_SCHMA (O17453) 26S proteasome non-ATPase regulatory subunit 4 (26S| proteasome regulatory subunit S5A) Length = 420 Score = 35.4 bits (80), Expect = 0.17 Identities = 20/51 (39%), Positives = 27/51 (52%), Gaps = 2/51 (3%) Frame = -3 Query: 378 VFEDRSFVTSILNSLPGVDPNDPSVKDLLASLHGQGEQ--EKKDEADKTDK 232 V D F+ S+L SLPGVD + V+ + +L Q KKDE + DK Sbjct: 367 VMYDAEFLESVLQSLPGVDTQNEDVRKAINALTKSQSQRGSKKDEKEDEDK 417
>RINT1_DROME (Q9VS46) RINT1-like protein (DmRINT-1)| Length = 724 Score = 31.2 bits (69), Expect = 3.2 Identities = 31/118 (26%), Positives = 48/118 (40%), Gaps = 4/118 (3%) Frame = +3 Query: 96 SYRQRSYKRIK*IHS----PSVKAANAGNLLPFFMCMKQQRDFSSSHLQACLSCPPHLSS 263 S+RQR + +HS PS+ NA N L + + + HL A L+ P Sbjct: 468 SFRQRLVQ----LHSSGAVPSIPILNAINYLVMVL-REWGENVHYLHLHAALAGPNATEI 522 Query: 264 PALLGHAKMPVDLSQMGHWGQHQEAN*GWMSQMICLQTLCSYQIDQTPLRPEQTFEEP 437 ++ HA ++++ HW + N + SY+ D P PEQ EP Sbjct: 523 NSVFEHA-----VAELEHWARQLMRNLATKATNEMKAKSMSYRRDAWPTMPEQNSREP 575 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 76,720,246 Number of Sequences: 219361 Number of extensions: 1341811 Number of successful extensions: 3908 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 3692 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3902 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 6969622431 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)