| Clone Name | rbags29h21 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | SAS10_YEAST (Q12136) Something about silencing protein 10 (U3 sm... | 30 | 5.3 | 2 | RELN_HUMAN (P78509) Reelin precursor (EC 3.4.21.-) | 30 | 9.1 |
|---|
>SAS10_YEAST (Q12136) Something about silencing protein 10 (U3 small nucleolar| RNA-associated protein 3) (U3 snoRNA-associated protein 11) Length = 610 Score = 30.4 bits (67), Expect = 5.3 Identities = 15/49 (30%), Positives = 26/49 (53%) Frame = -2 Query: 573 HLEEVILHPQVSQETQKQWEKAAEDHPNGPKVLLFKSGDEAESSNDQLN 427 HLEE+ ++ + +E +++W K+A++ G K D S D LN Sbjct: 155 HLEELNMNDYLDEEEEEEWVKSAKEFDMGEFKNSTKQADTKTSITDILN 203
>RELN_HUMAN (P78509) Reelin precursor (EC 3.4.21.-)| Length = 3460 Score = 29.6 bits (65), Expect = 9.1 Identities = 15/52 (28%), Positives = 25/52 (48%) Frame = -2 Query: 540 SQETQKQWEKAAEDHPNGPKVLLFKSGDEAESSNDQLNPAFSRMGISEVCPP 385 +++ Q+QW + E P G VL G E + L+ F + G ++C P Sbjct: 413 TEDIQEQWSEEFESQPTGWDVLGAVIGTECGTIESGLSMVFLKDGERKLCTP 464 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 98,630,387 Number of Sequences: 219361 Number of extensions: 1966904 Number of successful extensions: 4965 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4850 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4965 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 6856295237 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)