| Clone Name | rbaal1j19 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | G6PI_STAS1 (Q49WA1) Glucose-6-phosphate isomerase (EC 5.3.1.9) (... | 28 | 5.3 | 2 | T2R40_HUMAN (P59535) Taste receptor type 2 member 40 (T2R40) (T2... | 28 | 6.9 | 3 | SYL_MESFL (Q6F0X5) Leucyl-tRNA synthetase (EC 6.1.1.4) (Leucine-... | 27 | 9.0 |
|---|
>G6PI_STAS1 (Q49WA1) Glucose-6-phosphate isomerase (EC 5.3.1.9) (GPI)| (Phosphoglucose isomerase) (PGI) (Phosphohexose isomerase) (PHI) Length = 443 Score = 28.1 bits (61), Expect = 5.3 Identities = 14/47 (29%), Positives = 26/47 (55%) Frame = -3 Query: 340 SWLVGLSDADAADAAERFSEQWPTDLVVGNHDCRDYTNGLVEVLTGQ 200 S+L + + ++ R S+++P + VGNH YT L++ L G+ Sbjct: 84 SYLGARAAIEMLTSSFRNSDEYPEIVFVGNHLSSTYTQELIDYLDGK 130
>T2R40_HUMAN (P59535) Taste receptor type 2 member 40 (T2R40) (T2R58) (G-protein| coupled receptor 60) Length = 323 Score = 27.7 bits (60), Expect = 6.9 Identities = 14/30 (46%), Positives = 19/30 (63%) Frame = -2 Query: 125 FLLLLPFCSVALVLFTPHIASKYS*CNLLC 36 FL+L F ++AL L T +I YS N+LC Sbjct: 252 FLILYIFNAIALFLSTSNIFDTYSSWNILC 281
>SYL_MESFL (Q6F0X5) Leucyl-tRNA synthetase (EC 6.1.1.4) (Leucine--tRNA ligase)| (LeuRS) Length = 801 Score = 27.3 bits (59), Expect = 9.0 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -3 Query: 319 DADAADAAERFSEQWPTDLVVGNHD 245 D D+A+A +RF + P DL VG + Sbjct: 510 DIDSAEAKKRFEKWMPVDLYVGGQE 534 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 43,141,298 Number of Sequences: 219361 Number of extensions: 695141 Number of successful extensions: 2169 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2137 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2169 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 1370455656 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)