| Clone Name | rbags28p23 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | GP112_HUMAN (Q8IZF6) Probable G-protein coupled receptor 112 | 29 | 8.9 |
|---|
>GP112_HUMAN (Q8IZF6) Probable G-protein coupled receptor 112| Length = 2799 Score = 29.3 bits (64), Expect = 8.9 Identities = 18/48 (37%), Positives = 28/48 (58%) Frame = -3 Query: 483 LPTATLSSS*WDVV*ILSSPRNFSIPEDTADSQSLLDTYTIATACKGS 340 LP++T++SS W+ + SSP IP+ T D SLL+ T + G+ Sbjct: 2083 LPSSTITSS-WNRIPTASSPSTLIIPKPTLD--SLLNIMTTTSTVPGA 2127 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 75,593,662 Number of Sequences: 219361 Number of extensions: 1391968 Number of successful extensions: 3667 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 3573 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3666 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 5158951200 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)