| Clone Name | rbags28p21 |
|---|---|
| Clone Library Name | barley_pub |
>C1QL3_MOUSE (Q9ESN4) Complement C1q-like protein 3 precursor (Gliacolin)| Length = 255 Score = 30.4 bits (67), Expect = 2.7 Identities = 17/56 (30%), Positives = 23/56 (41%) Frame = -3 Query: 496 DGNC*WLTLVSVHDFEHSYIGTDVTAHKPNAAQIIILHLAPGTR*YMHRK*SGAHG 329 DG W L + S I D + A+ ++LHL PG Y+ AHG Sbjct: 183 DGTSMWADLCKNNQVRASAIAQDADQNYDYASNSVVLHLEPGDEVYIKLDGGKAHG 238
>TALDO_CARMA (P80427) Transaldolase (EC 2.2.1.2) (Fragments)| Length = 75 Score = 30.0 bits (66), Expect = 3.6 Identities = 16/40 (40%), Positives = 24/40 (60%), Gaps = 4/40 (10%) Frame = -2 Query: 314 PVLVLDS----EVQNSKNIYPIWKSEMKLEHTCDIRAEQL 207 P L+L + E+QNSK IY +K E +EH + A++L Sbjct: 11 PSLILQAKFLEELQNSKKIYNYYKKESVVEHLSESSAKKL 50
>RIR2_HELPY (P55983) Ribonucleoside-diphosphate reductase beta subunit (EC| 1.17.4.1) (Ribonucleotide reductase small subunit) Length = 341 Score = 29.6 bits (65), Expect = 4.7 Identities = 11/38 (28%), Positives = 25/38 (65%) Frame = -2 Query: 326 HTHLPVLVLDSEVQNSKNIYPIWKSEMKLEHTCDIRAE 213 H+H ++++S N++ IY +W+++M+L+ D A+ Sbjct: 123 HSHAYAVMVESISANTEEIYDMWRNDMQLKSKNDYIAQ 160
>RIR2_HELPJ (Q9ZKC3) Ribonucleoside-diphosphate reductase beta subunit (EC| 1.17.4.1) (Ribonucleotide reductase small subunit) Length = 341 Score = 29.6 bits (65), Expect = 4.7 Identities = 11/38 (28%), Positives = 25/38 (65%) Frame = -2 Query: 326 HTHLPVLVLDSEVQNSKNIYPIWKSEMKLEHTCDIRAE 213 H+H ++++S N++ IY +W+++M+L+ D A+ Sbjct: 123 HSHAYAVMVESISANTEEIYDMWRNDMQLKSKNDYIAQ 160
>SYL_RHOPA (Q6ND22) Leucyl-tRNA synthetase (EC 6.1.1.4) (Leucine--tRNA ligase)| (LeuRS) Length = 876 Score = 29.3 bits (64), Expect = 6.1 Identities = 10/18 (55%), Positives = 14/18 (77%) Frame = +2 Query: 125 PRGPDIWNRLKPIDQYMG 178 P PD+ NR+ P+DQY+G Sbjct: 528 PTTPDVVNRMMPVDQYIG 545
>SKEL_DROME (Q9GPJ1) Protein skeletor| Length = 743 Score = 29.3 bits (64), Expect = 6.1 Identities = 12/37 (32%), Positives = 21/37 (56%) Frame = +1 Query: 388 ILLSGQHLVYGPSHLYQCNYAQNHGQIPASAISSYHH 498 IL +G HL++ P HL++ ++ H P + +HH Sbjct: 138 ILAAGPHLIHHPPHLHRLHHQPQHA--PHPHVHLHHH 172 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 75,425,506 Number of Sequences: 219361 Number of extensions: 1624221 Number of successful extensions: 3258 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 3198 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3258 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3523384522 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)