| Clone Name | rbaal1j04 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | TS1R2_RAT (Q9Z0R7) Taste receptor type 1 member 2 precursor (G-p... | 33 | 0.76 | 2 | RSC3_YEAST (Q06639) Chromatin structure remodeling complex prote... | 31 | 2.9 | 3 | TX26_PHONI (P29425) Neurotoxin Tx2-6 precursor | 30 | 4.9 |
|---|
>TS1R2_RAT (Q9Z0R7) Taste receptor type 1 member 2 precursor (G-protein| coupled receptor 71) (Sweet taste receptor T1R2) Length = 843 Score = 33.1 bits (74), Expect = 0.76 Identities = 21/63 (33%), Positives = 28/63 (44%), Gaps = 5/63 (7%) Frame = -2 Query: 662 PIQSGCCKPPTSCAFTY-NNETYWSANPGVPTVVTDPDC----LKWSNDQQTLCFQCDSC 498 P QS PTS TY NN ++++ N VP + C +K S CF+C C Sbjct: 465 PFQSIASYSPTSKRLTYINNVSWYTPNNTVPVSMCSKSCQPGQMKKSVGLHPCCFECLDC 524 Query: 497 KAG 489 G Sbjct: 525 MPG 527
>RSC3_YEAST (Q06639) Chromatin structure remodeling complex protein RSC3| (Remodel the structure of chromatin complex subunit 3) Length = 885 Score = 31.2 bits (69), Expect = 2.9 Identities = 23/75 (30%), Positives = 33/75 (44%), Gaps = 1/75 (1%) Frame = +2 Query: 41 LQXLILYHQIQNRPTL-NTTEPKHHTKHFDPRTPSLSHNPATG*SXXXXXXNTVQQEI*F 217 LQ L +Q+ NR + N T + HT++ PSL P T + N VQ F Sbjct: 106 LQLLNAQNQLNNRSSAANATLNQQHTQYIPKSVPSLESKPVTSANESSTPLNWVQGPAIF 165 Query: 218 RPKVLTPPPTTSGLL 262 +LT P T ++ Sbjct: 166 H--MLTSPYTQDEII 178
>TX26_PHONI (P29425) Neurotoxin Tx2-6 precursor| Length = 82 Score = 30.4 bits (67), Expect = 4.9 Identities = 17/45 (37%), Positives = 23/45 (51%) Frame = -1 Query: 171 DHPVAGLCEREGVLGSKCLVWCLGSVVFRVGLFCIWWYKMRXCKE 37 D P C+ G G +C+ C G + R G F I WYK+ CK+ Sbjct: 41 DQPCKETCDCCGERG-ECV--CGGPCICRQGYFWIAWYKLANCKK 82 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 82,643,113 Number of Sequences: 219361 Number of extensions: 1575601 Number of successful extensions: 4440 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4282 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4437 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6370891296 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)