| Clone Name | rbags29c03 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | RM05_MARPO (P26860) Mitochondrial 60S ribosomal protein L5 | 32 | 2.2 | 2 | UCK2_MOUSE (Q99PM9) Uridine-cytidine kinase 2 (EC 2.7.1.48) (UCK... | 30 | 4.9 | 3 | AGAL2_PEDPE (P43469) Alpha-galactosidase 2 (EC 3.2.1.22) (Melibi... | 26 | 7.9 |
|---|
>RM05_MARPO (P26860) Mitochondrial 60S ribosomal protein L5| Length = 188 Score = 31.6 bits (70), Expect = 2.2 Identities = 15/58 (25%), Positives = 31/58 (53%) Frame = +2 Query: 2 NLIDKIGNFLXLYNLHVEIKRGTVQHQYATSTNPVHIKTTDRFDRFQHRYELERHIIT 175 N ++K+ + Y+ V+I++ ++Q ATS + + D F+ F+H + I+T Sbjct: 111 NFLEKLVTIISFYDYPVKIQKNSIQLSMATSLLRLFPEIQDHFEIFEHIRGFDVTIVT 168
>UCK2_MOUSE (Q99PM9) Uridine-cytidine kinase 2 (EC 2.7.1.48) (UCK 2) (Uridine| monophosphokinase 2) (Cytidine monophosphokinase 2) Length = 261 Score = 30.4 bits (67), Expect = 4.9 Identities = 12/28 (42%), Positives = 20/28 (71%) Frame = -2 Query: 574 LGRNEKSYHQPILIVEAEDFFYDMPTAE 491 LG+NE YHQ +++ ++D FY + T+E Sbjct: 44 LGQNEVDYHQKQVVILSQDSFYRVLTSE 71
>AGAL2_PEDPE (P43469) Alpha-galactosidase 2 (EC 3.2.1.22) (Melibiase)| Length = 719 Score = 25.8 bits (55), Expect(2) = 7.9 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = +2 Query: 281 LSSTYLVYITTSHTALTYQGFQYHTKHPAFS 373 LSS L T +TALT G H +P+F+ Sbjct: 176 LSSAQLDLPTDQYTALTLSGTHAHEANPSFN 206 Score = 22.3 bits (46), Expect(2) = 7.9 Identities = 12/25 (48%), Positives = 17/25 (68%), Gaps = 1/25 (4%) Frame = +1 Query: 202 FDNQDMIHRVTTIVHLEST-LDITA 273 F+NQ +I R TT+ H +T L +TA Sbjct: 151 FENQPLILRSTTLRHHGTTNLQVTA 175 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 88,552,408 Number of Sequences: 219361 Number of extensions: 1717046 Number of successful extensions: 3997 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3904 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3997 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6314008338 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)