| Clone Name | rbaal1j03 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ABC3F_HUMAN (Q8IUX4) DNA dC->dU-editing enzyme APOBEC-3F (EC 3.5... | 34 | 0.26 | 2 | RPB5_YEAST (P20434) DNA-directed RNA polymerases I, II, and III ... | 31 | 2.2 |
|---|
>ABC3F_HUMAN (Q8IUX4) DNA dC->dU-editing enzyme APOBEC-3F (EC 3.5.4.-)| (Apolipoprotein B mRNA-editing enzyme catalytic polypeptide-like 3F) Length = 373 Score = 33.9 bits (76), Expect = 0.26 Identities = 20/65 (30%), Positives = 33/65 (50%), Gaps = 1/65 (1%) Frame = -2 Query: 450 YSQWEAFIAGY-FD*FPNYGFVTDVLVVMFHTPVECCYPMICMKHFEML*RKSSRWQLYC 274 YS+ + F+ Y FD NY F+ L + P+E YP I HF+ L + R + + Sbjct: 161 YSEGQPFMPWYKFD--DNYAFLHRTLKEILRNPMEAMYPHIFYFHFKNLRKAYGRNESWL 218 Query: 273 CYSCD 259 C++ + Sbjct: 219 CFTME 223
>RPB5_YEAST (P20434) DNA-directed RNA polymerases I, II, and III 27 kDa| polypeptide (EC 2.7.7.6) (ABC27) Length = 215 Score = 30.8 bits (68), Expect = 2.2 Identities = 17/49 (34%), Positives = 26/49 (53%), Gaps = 2/49 (4%) Frame = +1 Query: 166 FVYEGNNSPLQEEIISSFPP*TLLAATYAVAITGVAAVELPPR--RLSS 306 FVY+ N +P +++ S PP T+ A + + EL P+ RLSS Sbjct: 110 FVYQNNITPSAMKLVPSIPPATIETFNEAALVVNITHHELVPKHIRLSS 158 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 67,174,131 Number of Sequences: 219361 Number of extensions: 1232086 Number of successful extensions: 2758 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2716 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2756 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3638905326 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)