| Clone Name | rbags29b23 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PUB14_ARATH (Q8VZ40) E3 ubiquitin ligase PUB14 (EC 6.3.2.-) (Pro... | 56 | 9e-08 | 2 | SPL11_ORYSA (Q64HA9) Spotted leaf protein 11 (Spotted leaf11) (C... | 52 | 2e-06 | 3 | GLT1_SCHPO (Q9C102) Putative glutamate synthase [NADPH] (EC 1.4.... | 29 | 9.2 |
|---|
>PUB14_ARATH (Q8VZ40) E3 ubiquitin ligase PUB14 (EC 6.3.2.-) (Prototypical U-box| domain protein 14) Length = 632 Score = 55.8 bits (133), Expect = 9e-08 Identities = 26/67 (38%), Positives = 38/67 (56%), Gaps = 3/67 (4%) Frame = -3 Query: 424 VPSFFLCPILKETMDDPQVAADGVTYEGRAIREWIEDGRAV---ADLKLRHLGLTPNHAL 254 +P +F CPI E M DP + + G TYE +I++W++ G + L H GLTPN+ L Sbjct: 248 IPEYFRCPISLELMKDPVIVSTGQTYERSSIQKWLDAGHKTCPKSQETLLHAGLTPNYVL 307 Query: 253 RFAIQDW 233 + I W Sbjct: 308 KSLIALW 314
>SPL11_ORYSA (Q64HA9) Spotted leaf protein 11 (Spotted leaf11) (Cell| death-related protein SPL11) Length = 694 Score = 51.6 bits (122), Expect = 2e-06 Identities = 26/67 (38%), Positives = 32/67 (47%), Gaps = 3/67 (4%) Frame = -3 Query: 424 VPSFFLCPILKETMDDPQVAADGVTYEGRAIREWIEDGR---AVADLKLRHLGLTPNHAL 254 +P F CPI E M DP + + G TYE I +WI G K+ LTPN+ L Sbjct: 273 IPDEFRCPISLELMKDPVIVSTGQTYERACIEKWIASGHHTCPTTQQKMSTSALTPNYVL 332 Query: 253 RFAIQDW 233 R I W Sbjct: 333 RSLISQW 339
>GLT1_SCHPO (Q9C102) Putative glutamate synthase [NADPH] (EC 1.4.1.13)| (NADPH-GOGAT) Length = 2111 Score = 29.3 bits (64), Expect = 9.2 Identities = 16/54 (29%), Positives = 27/54 (50%) Frame = -3 Query: 385 MDDPQVAADGVTYEGRAIREWIEDGRAVADLKLRHLGLTPNHALRFAIQDWLSQ 224 ++ ++ G Y GR + ++GR V D +L+H N A R+ + WL Q Sbjct: 447 IEPDRIVQKGRLYPGRMLLVDTKEGRIVDDKELKH-----NIASRYDFRSWLDQ 495 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 71,728,072 Number of Sequences: 219361 Number of extensions: 1224597 Number of successful extensions: 3230 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2935 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3226 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5310515667 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)