ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbags28l03 |
|---|---|
| Clone Library Name | barley_pub |
>CMC3_CAEEL (Q19529) Probable calcium-binding mitochondrial carrier F17E5.2| Length = 531 Score = 47.8 bits (112), Expect = 6e-06 Identities = 19/39 (48%), Positives = 29/39 (74%) Frame = -3 Query: 400 EGFGALYKGLVPNSVKVVPSIAIAFVTYEAVKDVLGVEM 284 EGF LY+G+ PN +KV+P+++I++V YE V+ LG M Sbjct: 492 EGFTGLYRGITPNFMKVIPAVSISYVVYEKVRKQLGATM 530 Score = 31.2 bits (69), Expect = 0.62 Identities = 12/34 (35%), Positives = 19/34 (55%) Frame = -3 Query: 400 EGFGALYKGLVPNSVKVVPSIAIAFVTYEAVKDV 299 EG YKG +PN + ++P I YE++K + Sbjct: 391 EGIKCFYKGYLPNLLGIIPYAGIDLTVYESLKSM 424
>CMC2_CAEEL (Q20799) Probable calcium-binding mitochondrial carrier F55A11.4| Length = 588 Score = 43.1 bits (100), Expect = 2e-04 Identities = 17/37 (45%), Positives = 27/37 (72%) Frame = -3 Query: 400 EGFGALYKGLVPNSVKVVPSIAIAFVTYEAVKDVLGV 290 EG Y+G+ PN +KV+P+++I++V YE V+ LGV Sbjct: 496 EGVTGFYRGITPNFLKVIPAVSISYVVYEKVRTGLGV 532 Score = 30.8 bits (68), Expect = 0.81 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = -3 Query: 400 EGFGALYKGLVPNSVKVVPSIAIAFVTYEAVK 305 EG YKG +PN + ++P I YE +K Sbjct: 395 EGIRCFYKGYLPNLIGIIPYAGIDLAIYETLK 426
>BT1_MAIZE (P29518) Protein brittle-1, chloroplast precursor| Length = 436 Score = 42.7 bits (99), Expect = 2e-04 Identities = 18/35 (51%), Positives = 26/35 (74%) Frame = -3 Query: 400 EGFGALYKGLVPNSVKVVPSIAIAFVTYEAVKDVL 296 EG G LY+GL P+ +K++P+ IAF+ YEA K +L Sbjct: 379 EGAGGLYRGLGPSCIKLMPAAGIAFMCYEACKKIL 413 Score = 32.3 bits (72), Expect = 0.28 Identities = 15/32 (46%), Positives = 19/32 (59%) Frame = -3 Query: 400 EGFGALYKGLVPNSVKVVPSIAIAFVTYEAVK 305 EG LY+GL P+ + VVP A F YE +K Sbjct: 278 EGPSELYRGLTPSLIGVVPYAACNFYAYETLK 309 Score = 29.6 bits (65), Expect = 1.8 Identities = 14/35 (40%), Positives = 20/35 (57%) Frame = -3 Query: 400 EGFGALYKGLVPNSVKVVPSIAIAFVTYEAVKDVL 296 EG+ L++G N ++V PS AI TY+ K L Sbjct: 183 EGWTGLFRGNAVNVLRVAPSKAIEHFTYDTAKKFL 217
>MFTC_MOUSE (Q8BMG8) Mitochondrial folate transporter/carrier (Solute carrier| family 25 member 32) Length = 316 Score = 40.8 bits (94), Expect = 8e-04 Identities = 17/35 (48%), Positives = 21/35 (60%) Frame = -3 Query: 400 EGFGALYKGLVPNSVKVVPSIAIAFVTYEAVKDVL 296 EG G YKG+ PN ++V P+ I FV YE V L Sbjct: 273 EGIGGFYKGIAPNLIRVTPACCITFVVYENVSHFL 307
>MFTC_MACFA (Q95J75) Mitochondrial folate transporter/carrier (Solute carrier| family 25 member 32) Length = 315 Score = 40.8 bits (94), Expect = 8e-04 Identities = 17/35 (48%), Positives = 21/35 (60%) Frame = -3 Query: 400 EGFGALYKGLVPNSVKVVPSIAIAFVTYEAVKDVL 296 EG G YKG+ PN ++V P+ I FV YE V L Sbjct: 273 EGIGGFYKGIAPNLIRVTPACCITFVVYENVSHFL 307
>CMC1_YEAST (P48233) Calcium-binding mitochondrial carrier SAL1 (Suppressor of| AAC2 lethality) Length = 545 Score = 40.4 bits (93), Expect = 0.001 Identities = 16/38 (42%), Positives = 27/38 (71%) Frame = -3 Query: 400 EGFGALYKGLVPNSVKVVPSIAIAFVTYEAVKDVLGVE 287 EG+ L+KGLVP KV P+++I+++ YE +K + +E Sbjct: 508 EGYQGLFKGLVPTLAKVCPAVSISYLCYENLKKFMNLE 545
>MFTC_HUMAN (Q9H2D1) Mitochondrial folate transporter/carrier (Solute carrier| family 25 member 32) Length = 315 Score = 40.4 bits (93), Expect = 0.001 Identities = 17/35 (48%), Positives = 21/35 (60%) Frame = -3 Query: 400 EGFGALYKGLVPNSVKVVPSIAIAFVTYEAVKDVL 296 EG G YKG+ PN ++V P+ I FV YE V L Sbjct: 273 EGVGGFYKGIAPNLIRVTPACCITFVVYENVSHFL 307
>SFC1_YEAST (P33303) Succinate/fumarate mitochondrial transporter (Regulator of| acetyl-CoA synthetase activity) Length = 322 Score = 39.7 bits (91), Expect = 0.002 Identities = 17/35 (48%), Positives = 23/35 (65%) Frame = -3 Query: 400 EGFGALYKGLVPNSVKVVPSIAIAFVTYEAVKDVL 296 EGF ALYKG+ P ++V P A+ F YE V++ L Sbjct: 270 EGFRALYKGITPRVMRVAPGQAVTFTVYEYVREHL 304 Score = 33.9 bits (76), Expect = 0.095 Identities = 16/35 (45%), Positives = 23/35 (65%) Frame = -3 Query: 400 EGFGALYKGLVPNSVKVVPSIAIAFVTYEAVKDVL 296 EGF ALYKGL + ++P +AI F +YE + +L Sbjct: 66 EGFLALYKGLGAVVIGIIPKMAIRFSSYEFYRTLL 100
>RIM2_YEAST (P38127) Mitochondrial carrier protein RIM2| Length = 377 Score = 39.3 bits (90), Expect = 0.002 Identities = 18/34 (52%), Positives = 24/34 (70%) Frame = -3 Query: 400 EGFGALYKGLVPNSVKVVPSIAIAFVTYEAVKDV 299 EGF +L+KGL PN V V+P+ +I F TY KD+ Sbjct: 130 EGFRSLFKGLGPNLVGVIPARSINFFTYGTTKDM 163 Score = 30.4 bits (67), Expect = 1.1 Identities = 13/31 (41%), Positives = 20/31 (64%) Frame = -3 Query: 400 EGFGALYKGLVPNSVKVVPSIAIAFVTYEAV 308 EG ++Y GL P+ ++ VP+ I F T+E V Sbjct: 342 EGLFSMYSGLTPHLMRTVPNSIIMFGTWEIV 372
>UCP4_HUMAN (O95847) Mitochondrial uncoupling protein 4 (UCP 4) (Solute carrier| family 25 member 27) Length = 323 Score = 36.6 bits (83), Expect = 0.015 Identities = 14/37 (37%), Positives = 27/37 (72%) Frame = -3 Query: 400 EGFGALYKGLVPNSVKVVPSIAIAFVTYEAVKDVLGV 290 EGF +LYKG +P+ +++ P + ++TYE ++++ GV Sbjct: 284 EGFMSLYKGFLPSWLRMTPWSMVFWLTYEKIREMSGV 320
>FLX1_YEAST (P40464) Mitochondrial FAD carrier protein FLX1| Length = 311 Score = 36.2 bits (82), Expect = 0.019 Identities = 16/32 (50%), Positives = 20/32 (62%) Frame = -3 Query: 400 EGFGALYKGLVPNSVKVVPSIAIAFVTYEAVK 305 +GF LYKGL N V+ +PS I F YE +K Sbjct: 277 DGFVGLYKGLSANLVRAIPSTCITFCVYENLK 308
>UCP5_MOUSE (Q9Z2B2) Brain mitochondrial carrier protein 1 (BMCP-1)| (Mitochondrial uncoupling protein 5) (UCP 5) (Solute carrier family 25 member 14) Length = 325 Score = 35.8 bits (81), Expect = 0.025 Identities = 17/32 (53%), Positives = 22/32 (68%) Frame = -3 Query: 400 EGFGALYKGLVPNSVKVVPSIAIAFVTYEAVK 305 EGF ALYKG PN +++ P I F+TYE +K Sbjct: 290 EGFFALYKGFWPNWLRLGPWNIIFFITYEQLK 321
>UCP5_HUMAN (O95258) Brain mitochondrial carrier protein 1 (BMCP-1)| (Mitochondrial uncoupling protein 5) (UCP 5) (Solute carrier family 25 member 14) Length = 325 Score = 35.8 bits (81), Expect = 0.025 Identities = 17/32 (53%), Positives = 22/32 (68%) Frame = -3 Query: 400 EGFGALYKGLVPNSVKVVPSIAIAFVTYEAVK 305 EGF ALYKG PN +++ P I F+TYE +K Sbjct: 290 EGFFALYKGFWPNWLRLGPWNIIFFITYEQLK 321
>YG5F_YEAST (P53320) Putative mitochondrial carrier YGR257C| Length = 366 Score = 35.0 bits (79), Expect = 0.043 Identities = 17/36 (47%), Positives = 20/36 (55%) Frame = -3 Query: 400 EGFGALYKGLVPNSVKVVPSIAIAFVTYEAVKDVLG 293 EG ALY GL +K+ PS AI +YE K V G Sbjct: 326 EGLAALYTGLAARVIKIRPSCAIMISSYEISKKVFG 361
>GDC_BOVIN (Q01888) Grave disease carrier protein (GDC) (Mitochondrial solute| carrier protein homolog) (Solute carrier family 25 member 16) Length = 330 Score = 34.3 bits (77), Expect = 0.073 Identities = 15/27 (55%), Positives = 20/27 (74%) Frame = -3 Query: 385 LYKGLVPNSVKVVPSIAIAFVTYEAVK 305 LY+GL N ++ VPS A+AF TYE +K Sbjct: 298 LYRGLSLNYIRCVPSQAVAFTTYELMK 324 Score = 28.5 bits (62), Expect = 4.0 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = -3 Query: 397 GFGALYKGLVPNSVKVVPSIAIAFVTYEAVKDV 299 GF Y+GL+P + + P ++F T+ +K V Sbjct: 182 GFLGFYRGLMPTILGMAPYAGVSFFTFGTLKSV 214
>GDC_MOUSE (Q8C0K5) Grave disease carrier protein homolog (GDC) (Mitochondrial| solute carrier protein homolog) (Solute carrier family 25 member 16) Length = 332 Score = 33.9 bits (76), Expect = 0.095 Identities = 14/27 (51%), Positives = 20/27 (74%) Frame = -3 Query: 385 LYKGLVPNSVKVVPSIAIAFVTYEAVK 305 LY+GL N ++ +PS A+AF TYE +K Sbjct: 300 LYRGLSLNYIRCIPSQAVAFTTYELMK 326 Score = 28.5 bits (62), Expect = 4.0 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = -3 Query: 397 GFGALYKGLVPNSVKVVPSIAIAFVTYEAVKDV 299 GF Y+GL+P + + P ++F T+ +K V Sbjct: 184 GFLGFYRGLMPTILGMAPYAGVSFFTFGTLKSV 216
>GDC_HUMAN (P16260) Grave disease carrier protein (GDC) (Grave disease| autoantigen) (GDA) (Mitochondrial solute carrier protein homolog) (Solute carrier family 25 member 16) Length = 332 Score = 33.9 bits (76), Expect = 0.095 Identities = 14/27 (51%), Positives = 20/27 (74%) Frame = -3 Query: 385 LYKGLVPNSVKVVPSIAIAFVTYEAVK 305 LY+GL N ++ +PS A+AF TYE +K Sbjct: 300 LYRGLSLNYIRCIPSQAVAFTTYELMK 326 Score = 28.9 bits (63), Expect = 3.1 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = -3 Query: 397 GFGALYKGLVPNSVKVVPSIAIAFVTYEAVKDV 299 GF Y+GL+P + + P ++F T+ +K V Sbjct: 184 GFFGFYRGLMPTILGMAPYAGVSFFTFGTLKSV 216 Score = 28.5 bits (62), Expect = 4.0 Identities = 14/41 (34%), Positives = 23/41 (56%) Frame = -3 Query: 400 EGFGALYKGLVPNSVKVVPSIAIAFVTYEAVKDVLGVEMRI 278 EGF LYKG +++ P AI F+ +E K ++ ++ I Sbjct: 87 EGFLGLYKGNGAMMIRIFPYGAIQFMAFEHYKTLITTKLGI 127
>TXTP_CAEEL (P34519) Putative tricarboxylate transport protein, mitochondrial| precursor (Citrate transport protein) (CTP) Length = 312 Score = 33.5 bits (75), Expect = 0.12 Identities = 15/37 (40%), Positives = 22/37 (59%) Frame = -3 Query: 400 EGFGALYKGLVPNSVKVVPSIAIAFVTYEAVKDVLGV 290 EGF A YKG VP +V + I F+ Y+++ + L V Sbjct: 270 EGFFAFYKGTVPRLSRVCLDVGITFMIYDSIIEFLDV 306 Score = 28.1 bits (61), Expect = 5.2 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = -3 Query: 400 EGFGALYKGLVPNSVKVVPSIAIAFVTYEAVKD 302 EG G +YKG+ K + AI F E +KD Sbjct: 175 EGLGGIYKGVTATMAKQGSNQAIRFFVMETLKD 207
>DIC_HUMAN (Q9UBX3) Mitochondrial dicarboxylate carrier (Solute carrier family| 25 member 10) Length = 287 Score = 32.3 bits (72), Expect = 0.28 Identities = 12/35 (34%), Positives = 22/35 (62%) Frame = -3 Query: 388 ALYKGLVPNSVKVVPSIAIAFVTYEAVKDVLGVEM 284 A YKGLVP ++++P + FV E ++ G+++ Sbjct: 251 AFYKGLVPAGIRLIPHTVLTFVFLEQLRKNFGIKV 285
>MCAT_ARATH (Q93XM7) Mitochondrial carnitine/acylcarnitine carrier-like protein| (Protein A BOUT DE SOUFFLE) (Carnitine/acylcarnitine translocase-like protein) (CAC-like protein) Length = 300 Score = 32.0 bits (71), Expect = 0.36 Identities = 15/36 (41%), Positives = 19/36 (52%) Frame = -3 Query: 400 EGFGALYKGLVPNSVKVVPSIAIAFVTYEAVKDVLG 293 EG LYKG P + VP+ A F+ YE + LG Sbjct: 265 EGVKGLYKGFGPAMARSVPANAACFLAYEMTRSSLG 300 Score = 29.6 bits (65), Expect = 1.8 Identities = 15/34 (44%), Positives = 17/34 (50%) Frame = -3 Query: 397 GFGALYKGLVPNSVKVVPSIAIAFVTYEAVKDVL 296 G L+KGL P + VP A F YEA K L Sbjct: 169 GARGLFKGLFPTFAREVPGNATMFAAYEAFKRFL 202
>CMC1_PONPY (Q5RBC8) Calcium-binding mitochondrial carrier protein Aralar1| (Mitochondrial aspartate glutamate carrier 1) (Solute carrier family 25 member 12) Length = 678 Score = 32.0 bits (71), Expect = 0.36 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = -3 Query: 400 EGFGALYKGLVPNSVKVVPSIAIAFVTYEAVKD 302 EGF LY+GL+P + V P AI + V+D Sbjct: 383 EGFFGLYRGLIPQLIGVAPEKAIKLTVNDFVRD 415
>CMC1_HUMAN (O75746) Calcium-binding mitochondrial carrier protein Aralar1| (Mitochondrial aspartate glutamate carrier 1) (Solute carrier family 25 member 12) Length = 678 Score = 32.0 bits (71), Expect = 0.36 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = -3 Query: 400 EGFGALYKGLVPNSVKVVPSIAIAFVTYEAVKD 302 EGF LY+GL+P + V P AI + V+D Sbjct: 383 EGFFGLYRGLIPQLIGVAPEKAIKLTVNDFVRD 415
>ODC_HUMAN (Q9BQT8) Mitochondrial 2-oxodicarboxylate carrier (Solute carrier| family 25 member 21) Length = 299 Score = 32.0 bits (71), Expect = 0.36 Identities = 14/36 (38%), Positives = 20/36 (55%) Frame = -3 Query: 400 EGFGALYKGLVPNSVKVVPSIAIAFVTYEAVKDVLG 293 EG YKG++P + P A+ F T+E K +LG Sbjct: 67 EGLFGFYKGILPPILAETPKRAVKFFTFEQYKKLLG 102 Score = 30.0 bits (66), Expect = 1.4 Identities = 13/29 (44%), Positives = 19/29 (65%) Frame = -3 Query: 400 EGFGALYKGLVPNSVKVVPSIAIAFVTYE 314 EG ALYKGL+P +++ P A+ + YE Sbjct: 261 EGILALYKGLLPKIMRLGPGGAVMLLVYE 289
>CMC1_MOUSE (Q8BH59) Calcium-binding mitochondrial carrier protein Aralar1| (Mitochondrial aspartate glutamate carrier 1) (Solute carrier family 25 member 12) Length = 677 Score = 32.0 bits (71), Expect = 0.36 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = -3 Query: 400 EGFGALYKGLVPNSVKVVPSIAIAFVTYEAVKD 302 EGF LY+GL+P + V P AI + V+D Sbjct: 383 EGFFGLYRGLIPQLIGVAPEKAIKLTVNDFVRD 415
>CMC1_DROME (Q9VA73) Calcium-binding mitochondrial carrier Aralar1| Length = 695 Score = 31.6 bits (70), Expect = 0.47 Identities = 15/35 (42%), Positives = 20/35 (57%) Frame = -3 Query: 400 EGFGALYKGLVPNSVKVVPSIAIAFVTYEAVKDVL 296 EGF LY+GL+P + V P AI + V+D L Sbjct: 398 EGFMGLYRGLLPQLMGVAPEKAIKLTVNDLVRDKL 432
>ODC_RAT (Q99JD3) Mitochondrial 2-oxodicarboxylate carrier (Solute carrier| family 25 member 21) Length = 298 Score = 31.6 bits (70), Expect = 0.47 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = -3 Query: 400 EGFGALYKGLVPNSVKVVPSIAIAFVTYEAVKDVLG 293 EG YKG++P + P A+ F T+E K LG Sbjct: 66 EGLFGFYKGIIPPILAETPKRAVKFSTFELYKKFLG 101 Score = 28.5 bits (62), Expect = 4.0 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = -3 Query: 400 EGFGALYKGLVPNSVKVVPSIAIAFVTYE 314 EG ALYKGL+P +++ P + + YE Sbjct: 260 EGILALYKGLLPKVMRLGPGGGVMLLVYE 288
>ODC_MOUSE (Q8BZ09) Mitochondrial 2-oxodicarboxylate carrier (Solute carrier| family 25 member 21) Length = 298 Score = 31.6 bits (70), Expect = 0.47 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = -3 Query: 400 EGFGALYKGLVPNSVKVVPSIAIAFVTYEAVKDVLG 293 EG YKG++P + P A+ F T+E K LG Sbjct: 66 EGLFGFYKGIIPPILAETPKRAVKFSTFELYKKFLG 101 Score = 29.6 bits (65), Expect = 1.8 Identities = 13/29 (44%), Positives = 18/29 (62%) Frame = -3 Query: 400 EGFGALYKGLVPNSVKVVPSIAIAFVTYE 314 EG ALYKGLVP +++ P + + YE Sbjct: 260 EGILALYKGLVPKVMRLGPGGGVMLLVYE 288
>MCATL_HUMAN (Q8N8R3) Mitchondrial carnitine/acylcarnitine carrier protein CACL| (CACT-like) (Solute carrier family 25 member 29) Length = 303 Score = 31.2 bits (69), Expect = 0.62 Identities = 13/38 (34%), Positives = 22/38 (57%) Frame = -3 Query: 400 EGFGALYKGLVPNSVKVVPSIAIAFVTYEAVKDVLGVE 287 EG + +G+V ++ PS + F+TY+A+ LG E Sbjct: 145 EGLRGVNRGMVSTLLRETPSFGVYFLTYDALTRALGCE 182
>YEA6_YEAST (P39953) Putative mitochondrial carrier YEL006W| Length = 335 Score = 31.2 bits (69), Expect = 0.62 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = -3 Query: 400 EGFGALYKGLVPNSVKVVPSIAIAFVTYEAVKDVL 296 EGF Y G N V+ VP+ + V++E K L Sbjct: 296 EGFAGFYSGFATNLVRTVPAAVVTLVSFEYSKKYL 330
>YMC2_YEAST (P38087) Carrier protein YMC2, mitochondrial precursor| Length = 329 Score = 30.4 bits (67), Expect = 1.1 Identities = 15/38 (39%), Positives = 19/38 (50%) Frame = -3 Query: 400 EGFGALYKGLVPNSVKVVPSIAIAFVTYEAVKDVLGVE 287 EG A +KG P V+ P F+T+E V LG E Sbjct: 292 EGIRAFFKGFGPTMVRSAPVNGATFLTFELVMRFLGEE 329
>CMC2_MACFA (Q8HXW2) Calcium-binding mitochondrial carrier protein Aralar2| (Mitochondrial aspartate glutamate carrier 2) (Solute carrier family 25 member 13) (Citrin) Length = 674 Score = 30.4 bits (67), Expect = 1.1 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = -3 Query: 400 EGFGALYKGLVPNSVKVVPSIAIAFVTYEAVKD 302 EGF LY+GL+P + V P AI + V+D Sbjct: 385 EGFFGLYRGLLPQLLGVAPEKAIKLTVNDFVRD 417
>MCAT_MACFA (Q8HXY2) Mitochondrial carnitine/acylcarnitine carrier protein| (Carnitine/acylcarnitine translocase) (CAC) (Solute carrier family 25 member 20) Length = 301 Score = 30.4 bits (67), Expect = 1.1 Identities = 14/37 (37%), Positives = 22/37 (59%) Frame = -3 Query: 397 GFGALYKGLVPNSVKVVPSIAIAFVTYEAVKDVLGVE 287 G +YKG V ++ VP+ + F+TYE VK++ E Sbjct: 164 GIRGIYKGTVVTLMRDVPASGMYFMTYEWVKNIFTPE 200
>CMC2_MOUSE (Q9QXX4) Calcium-binding mitochondrial carrier protein Aralar2| (Mitochondrial aspartate glutamate carrier 2) (Solute carrier family 25 member 13) (Citrin) Length = 676 Score = 30.4 bits (67), Expect = 1.1 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = -3 Query: 400 EGFGALYKGLVPNSVKVVPSIAIAFVTYEAVKD 302 EGF LY+GL+P + V P AI + V+D Sbjct: 386 EGFFGLYRGLLPQLLGVAPEKAIKLTVNDFVRD 418
>ODC1_YEAST (Q03028) Mitochondrial 2-oxodicarboxylate carrier 1| Length = 310 Score = 30.4 bits (67), Expect = 1.1 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = -3 Query: 400 EGFGALYKGLVPNSVKVVPSIAIAFVTYEAVKD 302 EGF ALYKG P +++ P + V + V D Sbjct: 267 EGFKALYKGFAPKVMRLAPGGGLLLVVFTNVMD 299
>CMC2_HUMAN (Q9UJS0) Calcium-binding mitochondrial carrier protein Aralar2| (Mitochondrial aspartate glutamate carrier 2) (Solute carrier family 25 member 13) (Citrin) Length = 675 Score = 30.4 bits (67), Expect = 1.1 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = -3 Query: 400 EGFGALYKGLVPNSVKVVPSIAIAFVTYEAVKD 302 EGF LY+GL+P + V P AI + V+D Sbjct: 385 EGFFGLYRGLLPQLLGVAPEKAIKLTVNDFVRD 417
>YMC1_YEAST (P32331) Carrier protein YMC1, mitochondrial precursor| Length = 307 Score = 30.0 bits (66), Expect = 1.4 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = -3 Query: 397 GFGALYKGLVPNSVKVVPSIAIAFVTYEAVKDVLG 293 G GA +KG P ++ P+ F T+E +LG Sbjct: 273 GIGAFFKGFGPTMLRAAPANGATFATFELAMRLLG 307
>ODC_PONPY (Q5RFB7) Mitochondrial 2-oxodicarboxylate carrier (Solute carrier| family 25 member 21) Length = 299 Score = 30.0 bits (66), Expect = 1.4 Identities = 13/29 (44%), Positives = 19/29 (65%) Frame = -3 Query: 400 EGFGALYKGLVPNSVKVVPSIAIAFVTYE 314 EG ALYKGL+P +++ P A+ + YE Sbjct: 261 EGILALYKGLLPKIMRLGPGGAVMLLVYE 289 Score = 28.9 bits (63), Expect = 3.1 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = -3 Query: 382 YKGLVPNSVKVVPSIAIAFVTYEAVKDVLG 293 YKG++P + P A+ F T+E K +LG Sbjct: 73 YKGILPPILAETPKRAVKFFTFEQYKKLLG 102
>YQ51_CAEEL (Q09461) Putative mitochondrial carrier C16C10.1| Length = 360 Score = 29.6 bits (65), Expect = 1.8 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = -3 Query: 397 GFGALYKGLVPNSVKVVPSIAIAFVTYEAVK 305 G A GLVP VKV PS AI YE K Sbjct: 323 GISAFSSGLVPRLVKVSPSCAIMISFYEYFK 353
>UCP3_MOUSE (P56501) Mitochondrial uncoupling protein 3 (UCP 3)| Length = 308 Score = 29.6 bits (65), Expect = 1.8 Identities = 15/35 (42%), Positives = 21/35 (60%) Frame = -3 Query: 400 EGFGALYKGLVPNSVKVVPSIAIAFVTYEAVKDVL 296 EG A YKG VP+ +++ + FVTYE +K L Sbjct: 263 EGPTAFYKGFVPSFLRLGAWNVMMFVTYEQLKRAL 297
>YD1K_SCHPO (Q10248) Putative mitochondrial carrier C4G9.20c| Length = 302 Score = 29.3 bits (64), Expect = 2.3 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = -3 Query: 397 GFGALYKGLVPNSVKVVPSIAIAFVTYEAV 308 G Y+G VP V+ P+ A+ F YE V Sbjct: 266 GLRGFYRGFVPVLVRAAPANAVTFYVYETV 295
>ORNT1_MOUSE (Q9WVD5) Mitochondrial ornithine transporter 1 (Solute carrier| family 25 member 15) Length = 301 Score = 29.3 bits (64), Expect = 2.3 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = -3 Query: 400 EGFGALYKGLVPNSVKVVPSIAIAFVTYE 314 EG ALY GL P ++ P+ F+ YE Sbjct: 260 EGITALYSGLKPTMIRAFPANGALFLAYE 288
>ORNT1_HUMAN (Q9Y619) Mitochondrial ornithine transporter 1 (Solute carrier| family 25 member 15) Length = 301 Score = 29.3 bits (64), Expect = 2.3 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = -3 Query: 400 EGFGALYKGLVPNSVKVVPSIAIAFVTYE 314 EG ALY GL P ++ P+ F+ YE Sbjct: 260 EGITALYSGLKPTMIRAFPANGALFLAYE 288
>UCP2_RAT (P56500) Mitochondrial uncoupling protein 2 (UCP 2)| Length = 309 Score = 29.3 bits (64), Expect = 2.3 Identities = 14/35 (40%), Positives = 21/35 (60%) Frame = -3 Query: 400 EGFGALYKGLVPNSVKVVPSIAIAFVTYEAVKDVL 296 EG A YKG +P+ +++ + FVTYE +K L Sbjct: 264 EGPRAFYKGFMPSFLRLGSWNVVMFVTYEQLKRAL 298
>UCP2_MOUSE (P70406) Mitochondrial uncoupling protein 2 (UCP 2) (UCPH)| Length = 309 Score = 29.3 bits (64), Expect = 2.3 Identities = 14/35 (40%), Positives = 21/35 (60%) Frame = -3 Query: 400 EGFGALYKGLVPNSVKVVPSIAIAFVTYEAVKDVL 296 EG A YKG +P+ +++ + FVTYE +K L Sbjct: 264 EGPRAFYKGFMPSFLRLGSWNVVMFVTYEQLKRAL 298
>UCP2_HUMAN (P55851) Mitochondrial uncoupling protein 2 (UCP 2) (UCPH)| Length = 309 Score = 29.3 bits (64), Expect = 2.3 Identities = 14/35 (40%), Positives = 21/35 (60%) Frame = -3 Query: 400 EGFGALYKGLVPNSVKVVPSIAIAFVTYEAVKDVL 296 EG A YKG +P+ +++ + FVTYE +K L Sbjct: 264 EGPRAFYKGFMPSFLRLGSWNVVMFVTYEQLKRAL 298 Score = 29.3 bits (64), Expect = 2.3 Identities = 14/35 (40%), Positives = 18/35 (51%) Frame = -3 Query: 400 EGFGALYKGLVPNSVKVVPSIAIAFVTYEAVKDVL 296 EGF L+KG PN + VTY+ +KD L Sbjct: 170 EGFRGLWKGTSPNVARNAIVNCAELVTYDLIKDAL 204
>UCP2_CANFA (Q9N2J1) Mitochondrial uncoupling protein 2 (UCP 2)| Length = 309 Score = 29.3 bits (64), Expect = 2.3 Identities = 14/35 (40%), Positives = 21/35 (60%) Frame = -3 Query: 400 EGFGALYKGLVPNSVKVVPSIAIAFVTYEAVKDVL 296 EG A YKG +P+ +++ + FVTYE +K L Sbjct: 264 EGPRAFYKGFMPSFLRLGSWNVVMFVTYEQLKRAL 298 Score = 29.3 bits (64), Expect = 2.3 Identities = 14/35 (40%), Positives = 18/35 (51%) Frame = -3 Query: 400 EGFGALYKGLVPNSVKVVPSIAIAFVTYEAVKDVL 296 EGF L+KG PN + VTY+ +KD L Sbjct: 170 EGFRGLWKGTSPNVARNAIVNCAELVTYDLIKDAL 204
>ODC2_YEAST (Q99297) Mitochondrial 2-oxodicarboxylate carrier 2| Length = 307 Score = 29.3 bits (64), Expect = 2.3 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = -3 Query: 400 EGFGALYKGLVPNSVKVVPSIAIAFVTY 317 EGF ALYKG VP ++ P ++ V + Sbjct: 266 EGFRALYKGFVPKVCRLAPGGSLMLVVF 293
>MCATL_MOUSE (Q8BL03) Mitchondrial carnitine/acylcarnitine carrier protein CACL| (CACT-like) (Solute carrier family 25 member 29) Length = 306 Score = 29.3 bits (64), Expect = 2.3 Identities = 11/38 (28%), Positives = 21/38 (55%) Frame = -3 Query: 400 EGFGALYKGLVPNSVKVVPSIAIAFVTYEAVKDVLGVE 287 EG + +G+V ++ PS + F+TY+ + +G E Sbjct: 145 EGLRGINRGMVSTLLRETPSFGVYFLTYDVMTRAMGCE 182
>UCP3_CANFA (Q9N2I9) Mitochondrial uncoupling protein 3 (UCP 3)| Length = 311 Score = 28.9 bits (63), Expect = 3.1 Identities = 14/35 (40%), Positives = 20/35 (57%) Frame = -3 Query: 400 EGFGALYKGLVPNSVKVVPSIAIAFVTYEAVKDVL 296 EG A YKG P+ +++ + FVTYE +K L Sbjct: 266 EGPTAFYKGFTPSFLRLGTWNVVMFVTYEQLKRAL 300
>UCP3_BOVIN (O77792) Mitochondrial uncoupling protein 3 (UCP 3)| Length = 311 Score = 28.9 bits (63), Expect = 3.1 Identities = 14/35 (40%), Positives = 20/35 (57%) Frame = -3 Query: 400 EGFGALYKGLVPNSVKVVPSIAIAFVTYEAVKDVL 296 EG A YKG P+ +++ + FVTYE +K L Sbjct: 266 EGPTAFYKGFTPSFLRLGSWNVVMFVTYEQMKRAL 300
>YIA6_YEAST (P40556) Putative mitochondrial carrier YIL006W| Length = 373 Score = 28.9 bits (63), Expect = 3.1 Identities = 16/32 (50%), Positives = 21/32 (65%) Frame = -3 Query: 400 EGFGALYKGLVPNSVKVVPSIAIAFVTYEAVK 305 EGF ALY GLVP+ + + +AI F YE +K Sbjct: 231 EGFKALYAGLVPSLLGLF-HVAIHFPIYEDLK 261
>MCAT_HUMAN (O43772) Mitochondrial carnitine/acylcarnitine carrier protein| (Carnitine/acylcarnitine translocase) (CAC) (Solute carrier family 25 member 20) Length = 301 Score = 28.9 bits (63), Expect = 3.1 Identities = 13/37 (35%), Positives = 22/37 (59%) Frame = -3 Query: 397 GFGALYKGLVPNSVKVVPSIAIAFVTYEAVKDVLGVE 287 G +YKG V ++ VP+ + F+TYE +K++ E Sbjct: 164 GIRGIYKGTVLTLMRDVPASGMYFMTYEWLKNIFTPE 200
>UCP2_CYPCA (Q9W725) Mitochondrial uncoupling protein 2 (UCP 2)| Length = 310 Score = 28.9 bits (63), Expect = 3.1 Identities = 14/35 (40%), Positives = 18/35 (51%) Frame = -3 Query: 400 EGFGALYKGLVPNSVKVVPSIAIAFVTYEAVKDVL 296 EGF L+KG PN + VTY+ +KD L Sbjct: 171 EGFRGLWKGTGPNITRNAIVNCTELVTYDLIKDAL 205 Score = 28.5 bits (62), Expect = 4.0 Identities = 13/32 (40%), Positives = 20/32 (62%) Frame = -3 Query: 400 EGFGALYKGLVPNSVKVVPSIAIAFVTYEAVK 305 EG A YKG +P+ +++ + FVTYE +K Sbjct: 265 EGPKAFYKGFMPSFLRLGSWNVVMFVTYEQLK 296
>UCP2_BRARE (Q9W720) Mitochondrial uncoupling protein 2 (UCP 2)| Length = 310 Score = 28.9 bits (63), Expect = 3.1 Identities = 14/35 (40%), Positives = 18/35 (51%) Frame = -3 Query: 400 EGFGALYKGLVPNSVKVVPSIAIAFVTYEAVKDVL 296 EGF L+KG PN + VTY+ +KD L Sbjct: 171 EGFRGLWKGTGPNITRNAIVNCTELVTYDLIKDAL 205
>UCP2_PIG (O97562) Mitochondrial uncoupling protein 2 (UCP 2)| Length = 309 Score = 28.9 bits (63), Expect = 3.1 Identities = 14/35 (40%), Positives = 20/35 (57%) Frame = -3 Query: 400 EGFGALYKGLVPNSVKVVPSIAIAFVTYEAVKDVL 296 EG A YKG P+ +++ + FVTYE +K L Sbjct: 264 EGPRAFYKGFTPSFLRLGSWNVVMFVTYEQLKRAL 298
>GDC_RAT (P16261) Grave disease carrier protein (GDC) (Mitochondrial solute| carrier protein homolog) (Solute carrier family 25 member 16) (Fragment) Length = 322 Score = 28.9 bits (63), Expect = 3.1 Identities = 11/33 (33%), Positives = 20/33 (60%) Frame = -3 Query: 397 GFGALYKGLVPNSVKVVPSIAIAFVTYEAVKDV 299 GF Y+GL+P + + P +++F T+ +K V Sbjct: 187 GFLGFYRGLMPTILGMAPYASVSFFTFGTLKSV 219
>UCP3_HUMAN (P55916) Mitochondrial uncoupling protein 3 (UCP 3)| Length = 312 Score = 28.9 bits (63), Expect = 3.1 Identities = 14/35 (40%), Positives = 20/35 (57%) Frame = -3 Query: 400 EGFGALYKGLVPNSVKVVPSIAIAFVTYEAVKDVL 296 EG A YKG P+ +++ + FVTYE +K L Sbjct: 267 EGPTAFYKGFTPSFLRLGSWNVVMFVTYEQLKRAL 301
>MUC5B_HUMAN (Q9HC84) Mucin-5B precursor (Mucin 5 subtype B, tracheobronchial)| (High molecular weight salivary mucin MG1) (Sublingual gland mucin) Length = 5703 Score = 28.5 bits (62), Expect = 4.0 Identities = 18/40 (45%), Positives = 21/40 (52%), Gaps = 6/40 (15%) Frame = +3 Query: 252 TALGPILQSIL------ISTPRTSFTASYVTNAMAIEGTT 353 T+L P L S L STPRT T S +TN +GTT Sbjct: 1744 TSLAPTLTSELSTSQAETSTPRTETTMSPLTNTTTSQGTT 1783
>MPCP_CAEEL (P40614) Phosphate carrier protein, mitochondrial precursor (PTP)| Length = 340 Score = 28.5 bits (62), Expect = 4.0 Identities = 12/36 (33%), Positives = 21/36 (58%) Frame = -3 Query: 397 GFGALYKGLVPNSVKVVPSIAIAFVTYEAVKDVLGV 290 GF ++KGLVP + + A+ + Y++VK L + Sbjct: 285 GFAGVWKGLVPRIIMIGTLTALQWFIYDSVKVALNL 320
>UCP3_RAT (P56499) Mitochondrial uncoupling protein 3 (UCP 3)| Length = 308 Score = 28.5 bits (62), Expect = 4.0 Identities = 14/35 (40%), Positives = 21/35 (60%) Frame = -3 Query: 400 EGFGALYKGLVPNSVKVVPSIAIAFVTYEAVKDVL 296 EG A YKG +P+ +++ + FVTYE +K L Sbjct: 263 EGPTAFYKGFMPSFLRLGSWNVMMFVTYEQLKRAL 297
>ORNT2_HUMAN (Q9BXI2) Mitochondrial ornithine transporter 2 (Solute carrier| family 25 member 2) Length = 301 Score = 28.5 bits (62), Expect = 4.0 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = -3 Query: 400 EGFGALYKGLVPNSVKVVPSIAIAFVTYE 314 EG ALY GL ++ +P+ FV YE Sbjct: 260 EGIVALYSGLKATMIRAIPANGALFVAYE 288
>UCP1_MESAU (P04575) Mitochondrial brown fat uncoupling protein 1 (UCP 1)| (Thermogenin) Length = 306 Score = 28.5 bits (62), Expect = 4.0 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = -3 Query: 400 EGFGALYKGLVPNSVKVVPSIAIAFVTYEAVKDVL 296 E F L+KG PN ++ V + VTY+ +K L Sbjct: 167 ESFSTLWKGTTPNLLRNVIINCVELVTYDLMKGAL 201
>YE08_SCHPO (O13805) Putative mitochondrial carrier C17H9.08| Length = 326 Score = 28.5 bits (62), Expect = 4.0 Identities = 11/37 (29%), Positives = 20/37 (54%) Frame = -3 Query: 397 GFGALYKGLVPNSVKVVPSIAIAFVTYEAVKDVLGVE 287 G + GL +KV+P ++ +F Y K +LG++ Sbjct: 290 GMRGFFVGLTIGYIKVIPMVSTSFFVYNHSKALLGID 326 Score = 27.7 bits (60), Expect = 6.8 Identities = 14/34 (41%), Positives = 17/34 (50%) Frame = -3 Query: 397 GFGALYKGLVPNSVKVVPSIAIAFVTYEAVKDVL 296 G LY+G +V P I FV YE V+ VL Sbjct: 74 GLHGLYQGHTATLYRVFPYAGIKFVAYEQVRRVL 107
>PET8_ASHGO (O60029) Putative mitochondrial carrier protein PET8| Length = 271 Score = 28.1 bits (61), Expect = 5.2 Identities = 12/34 (35%), Positives = 20/34 (58%) Frame = -3 Query: 397 GFGALYKGLVPNSVKVVPSIAIAFVTYEAVKDVL 296 G+ +Y+GL V P ++ FVTY+++K L Sbjct: 44 GYRGIYRGLGSAVVASAPGASLFFVTYDSMKQQL 77
>LOX1_LENCU (P38414) Lipoxygenase (EC 1.13.11.12)| Length = 866 Score = 28.1 bits (61), Expect = 5.2 Identities = 14/37 (37%), Positives = 24/37 (64%) Frame = +1 Query: 25 DFMSQANALMLYSQLITFRSESAAAIRVPEPVVGYID 135 D +S+ + + L+S+L FRS+ AA++ P P V +D Sbjct: 328 DVLSKISPIPLFSEL--FRSDGEAALKFPPPKVIQVD 362
>MRS4_YEAST (P23500) Mitochondrial RNA-splicing protein MRS4| Length = 304 Score = 28.1 bits (61), Expect = 5.2 Identities = 12/34 (35%), Positives = 19/34 (55%) Frame = -3 Query: 397 GFGALYKGLVPNSVKVVPSIAIAFVTYEAVKDVL 296 G+ ++GL P V +P+ AI++ YE K L Sbjct: 268 GWKGFWRGLKPRIVANIPATAISWTAYECAKHFL 301
>IRAK4_HUMAN (Q9NWZ3) Interleukin-1 receptor-associated kinase 4 (EC 2.7.11.1)| (IRAK-4) (NY-REN-64 antigen) Length = 460 Score = 27.7 bits (60), Expect = 6.8 Identities = 14/41 (34%), Positives = 23/41 (56%), Gaps = 1/41 (2%) Frame = -3 Query: 397 GFGALYKGLVPNSVKVVPSI-AIAFVTYEAVKDVLGVEMRI 278 GFG +YKG V N+ V + A+ +T E +K E+++ Sbjct: 196 GFGVVYKGYVNNTTVAVKKLAAMVDITTEELKQQFDQEIKV 236
>HXB4A_BRARE (P22574) Homeobox protein Hox-B4a (Hox-B4) (Zf-13)| Length = 246 Score = 27.7 bits (60), Expect = 6.8 Identities = 16/40 (40%), Positives = 20/40 (50%) Frame = +2 Query: 164 EPRSYCPSTRPA*QKKGTQTPTKIEVDDTDSARSDSSVYP 283 EP +C S P+ QTPT + T S+R D VYP Sbjct: 94 EPSHHCDSVTPSPPPACGQTPTS-QNTSTVSSRKDPVVYP 132
>CMC1_CAEEL (Q21153) Probable calcium-binding mitochondrial carrier K02F3.2| Length = 707 Score = 27.3 bits (59), Expect = 8.9 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = -3 Query: 400 EGFGALYKGLVPNSVKVVPSIAIAFVTYEAVKD 302 EG LY+GL+P V V P AI + ++D Sbjct: 426 EGLLGLYRGLLPQIVGVAPEKAIKLTMNDYMRD 458
>UCP3_PIG (O97649) Mitochondrial uncoupling protein 3 (UCP 3)| Length = 308 Score = 27.3 bits (59), Expect = 8.9 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = -3 Query: 400 EGFGALYKGLVPNSVKVVPSIAIAFVTYEAVKDVL 296 EG A YKG P+ +++ + FV+YE +K L Sbjct: 263 EGPTAFYKGFTPSFLRLGSWNVVMFVSYEQLKRAL 297
>DNAA_STRA5 (Q8E2I7) Chromosomal replication initiator protein dnaA| Length = 453 Score = 27.3 bits (59), Expect = 8.9 Identities = 13/48 (27%), Positives = 26/48 (54%) Frame = +3 Query: 216 LKHLQK*KLMTRTALGPILQSILISTPRTSFTASYVTNAMAIEGTTFT 359 L +++ KL LGP++ + TA+YV+N + ++ T+F+ Sbjct: 46 LDNIEMKKLFWEQNLGPVILTAGFEIFNAEITANYVSNDLHLQETSFS 93
>DNAA_STRA3 (Q8E7Z4) Chromosomal replication initiator protein dnaA| Length = 453 Score = 27.3 bits (59), Expect = 8.9 Identities = 13/48 (27%), Positives = 26/48 (54%) Frame = +3 Query: 216 LKHLQK*KLMTRTALGPILQSILISTPRTSFTASYVTNAMAIEGTTFT 359 L +++ KL LGP++ + TA+YV+N + ++ T+F+ Sbjct: 46 LDNIEMKKLFWEQNLGPVILTAGFEIFNAEITANYVSNDLHLQETSFS 93
>Y185_METJA (Q57644) Hypothetical protein MJ0185| Length = 49 Score = 27.3 bits (59), Expect = 8.9 Identities = 13/38 (34%), Positives = 22/38 (57%), Gaps = 6/38 (15%) Frame = -3 Query: 388 ALYKGLVPN------SVKVVPSIAIAFVTYEAVKDVLG 293 +LYKGL PN S+ ++ +I I + A+K ++G Sbjct: 12 SLYKGLAPNSAIVGISIMIIIAIGIYLIIEYAIKKIIG 49
>MCAT_MOUSE (Q9Z2Z6) Mitochondrial carnitine/acylcarnitine carrier protein| (Carnitine/acylcarnitine translocase) (CAC) (mCAC) (Solute carrier family 25 member 20) Length = 301 Score = 27.3 bits (59), Expect = 8.9 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = -3 Query: 397 GFGALYKGLVPNSVKVVPSIAIAFVTYEAVKDVLGVE 287 G YKG V ++ VP+ + F+TYE +K++ E Sbjct: 164 GIRGFYKGTVLTLMRDVPASGMYFMTYEWLKNLFTPE 200
>IRAK4_MOUSE (Q8R4K2) Interleukin-1 receptor-associated kinase 4 (EC 2.7.11.1)| (IRAK-4) Length = 459 Score = 27.3 bits (59), Expect = 8.9 Identities = 13/41 (31%), Positives = 24/41 (58%), Gaps = 1/41 (2%) Frame = -3 Query: 397 GFGALYKGLVPNSVKVVPSI-AIAFVTYEAVKDVLGVEMRI 278 GFG +YKG V N++ V + A+ ++ E +K E+++ Sbjct: 196 GFGVVYKGCVNNTIVAVKKLGAMVEISTEELKQQFDQEIKV 236
>UCP1_CANFA (Q9GMZ1) Mitochondrial brown fat uncoupling protein 1 (UCP 1)| (Thermogenin) Length = 309 Score = 27.3 bits (59), Expect = 8.9 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = -3 Query: 400 EGFGALYKGLVPNSVKVVPSIAIAFVTYEAVKDVL 296 EG L+KG PN ++ V VTY+ +K+ L Sbjct: 170 EGLTGLWKGTTPNLMRNVIINCTELVTYDLMKEAL 204
>YD44_SCHPO (Q10298) Putative serine/threonine-protein phosphatase C22H10.04| (EC 3.1.3.16) Length = 307 Score = 27.3 bits (59), Expect = 8.9 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = +1 Query: 163 GASVLLSFYSPCLTKKGNSNTYK 231 G + FYS CL K GN+N +K Sbjct: 116 GITQTYGFYSECLRKYGNANVWK 138 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 52,194,994 Number of Sequences: 219361 Number of extensions: 926018 Number of successful extensions: 2493 Number of sequences better than 10.0: 77 Number of HSP's better than 10.0 without gapping: 2378 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2493 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 1359926328 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
