| Clone Name | rbaal1i15 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | THIE_HELPJ (Q9ZL01) Probable thiamine-phosphate pyrophosphorylas... | 28 | 4.8 | 2 | ASPM_SHEEP (P62297) Abnormal spindle-like microcephaly-associate... | 28 | 6.2 |
|---|
>THIE_HELPJ (Q9ZL01) Probable thiamine-phosphate pyrophosphorylase (EC 2.5.1.3)| (TMP pyrophosphorylase) (TMP-PPase) (Thiamine-phosphate synthase) Length = 217 Score = 28.5 bits (62), Expect = 4.8 Identities = 16/38 (42%), Positives = 23/38 (60%) Frame = +1 Query: 85 ERTTSLLSMLRFSHVTEKCTAFKFRCSSDLARVETVQI 198 +RT +LL L + + K TAF+FR DLA + V+I Sbjct: 24 DRTNALLDTLELA-LQSKITAFQFRQKGDLALQDPVEI 60
>ASPM_SHEEP (P62297) Abnormal spindle-like microcephaly-associated protein| homolog (Fragment) Length = 3374 Score = 28.1 bits (61), Expect = 6.2 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +3 Query: 9 SWNXGNEQAKTRXTTKLFACSCRLIRKDNKL 101 SW N+ +KT+ + C R IR++NKL Sbjct: 3137 SWRKKNDTSKTKAIRQRLQCVNREIREENKL 3167 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 29,552,634 Number of Sequences: 219361 Number of extensions: 418257 Number of successful extensions: 690 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 684 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 690 length of database: 80,573,946 effective HSP length: 59 effective length of database: 67,631,647 effective search space used: 1623159528 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)