| Clone Name | rbags28j04 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | NORM_RHIME (Q92PZ0) Probable multidrug resistance protein norM (... | 28 | 8.2 |
|---|
>NORM_RHIME (Q92PZ0) Probable multidrug resistance protein norM| (Multidrug-efflux transporter) Length = 467 Score = 27.7 bits (60), Expect = 8.2 Identities = 14/43 (32%), Positives = 21/43 (48%) Frame = -3 Query: 231 VLRQFVXSVRASGIQVQAVVYYKTLAAVLSYVYVKGRVNFPLL 103 VLR F+ + +G+ + + L A L YV + G FP L Sbjct: 158 VLRAFLSGLERAGVILYVTLVTLVLNAALCYVLIFGHFGFPEL 200 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 23,112,223 Number of Sequences: 219361 Number of extensions: 291475 Number of successful extensions: 560 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 558 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 560 length of database: 80,573,946 effective HSP length: 59 effective length of database: 67,631,647 effective search space used: 1623159528 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)