| Clone Name | rbags28g21 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | HTS1_COCCA (Q01886) HC-toxin synthetase (EC 6.3.2.-) (HTS) | 30 | 1.8 | 2 | YA4C_SCHPO (Q09729) Hypothetical protein C31A2.12 in chromosome I | 28 | 9.0 | 3 | LPXK_AZOSE (Q5P108) Tetraacyldisaccharide 4'-kinase (EC 2.7.1.13... | 28 | 9.0 |
|---|
>HTS1_COCCA (Q01886) HC-toxin synthetase (EC 6.3.2.-) (HTS)| Length = 5218 Score = 30.4 bits (67), Expect = 1.8 Identities = 12/27 (44%), Positives = 19/27 (70%) Frame = +2 Query: 203 GIAPAYALDINPRWIPTMRILISAGQP 283 GI P+ AL ++P +PT++ L AG+P Sbjct: 2071 GITPSLALHLDPDAVPTLKALCVAGEP 2097
>YA4C_SCHPO (Q09729) Hypothetical protein C31A2.12 in chromosome I| Length = 596 Score = 28.1 bits (61), Expect = 9.0 Identities = 24/86 (27%), Positives = 34/86 (39%) Frame = -3 Query: 379 RRSPNLPSQASNLPHLVALNLSRLKPRWWNQSRLASRNENPHRGNPSWVDIKCIRGCYPT 200 RR P+ ASN H L + Q + S NE+ +P G P+ Sbjct: 377 RRDSMEPTYASNEAHRRQLIAGLTELALQQQPQGRSPNEHSPSNHPEDFPPSFSLGSNPS 436 Query: 199 LSACSFLLFRNPFTRHV*RAVRVPAY 122 A S ++ RNP + RVP+Y Sbjct: 437 SGAASAVITRNPSETSLADLSRVPSY 462
>LPXK_AZOSE (Q5P108) Tetraacyldisaccharide 4'-kinase (EC 2.7.1.130) (Lipid A| 4'-kinase) Length = 336 Score = 28.1 bits (61), Expect = 9.0 Identities = 16/42 (38%), Positives = 24/42 (57%) Frame = -1 Query: 264 RIRIVGIHRGLISSAYAGAIPRSLLVPFYYFGIRLHGMYDEP 139 R+R G G++S Y G P +++VP + +RL G DEP Sbjct: 74 RLRDAGFTPGIVSRGYGGKAPGAVIVP-PHGDVRLFG--DEP 112 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 47,932,506 Number of Sequences: 219361 Number of extensions: 846746 Number of successful extensions: 1995 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1955 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1995 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2336739400 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)