| Clone Name | rbags28g07 |
|---|---|
| Clone Library Name | barley_pub |
>IBB_HORVU (P12940) Bowman-Birk type trypsin inhibitor| Length = 124 Score = 66.2 bits (160), Expect = 3e-11 Identities = 27/51 (52%), Positives = 35/51 (68%) Frame = -3 Query: 429 VCYRALPRACXCLDEVEQCAPTCKSCQLAPSDPSRHVCNDRYTGDIGPTCT 277 +C R+ P C C+DEV++CAPTCK+C + S PSR VC D Y G + P CT Sbjct: 72 ICTRSNPPTCRCVDEVKKCAPTCKTCLPSRSRPSRRVCIDSYFGPVPPRCT 122 Score = 65.1 bits (157), Expect = 7e-11 Identities = 27/50 (54%), Positives = 33/50 (66%) Frame = -3 Query: 429 VCYRALPRACXCLDEVEQCAPTCKSCQLAPSDPSRHVCNDRYTGDIGPTC 280 VC R++P C C+DEV +C TCKSC DPSR +C D+Y GD GP C Sbjct: 14 VCTRSIPPICTCMDEVFECPKTCKSCG-PMGDPSRRICQDQYVGDPGPIC 62
>IBBR_ORYSA (P07084) Bowman-Birk type bran trypsin inhibitor precursor (RBTI)| (OSE727A) Length = 195 Score = 62.0 bits (149), Expect = 6e-10 Identities = 25/50 (50%), Positives = 33/50 (66%), Gaps = 1/50 (2%) Frame = -3 Query: 426 CYRALPRACXCLDEVEQCAPTCKSCQ-LAPSDPSRHVCNDRYTGDIGPTC 280 C + P C C+DEV++CA CK CQ + S+P R+VC DR+TG GP C Sbjct: 140 CNKMNPPTCRCMDEVKECADACKDCQRVESSEPPRYVCKDRFTGHPGPVC 189 Score = 41.2 bits (95), Expect = 0.001 Identities = 23/49 (46%), Positives = 27/49 (55%), Gaps = 4/49 (8%) Frame = -3 Query: 411 PRACXCLDEVE--QCAPTCKSCQLAPSD-PSRHVCNDRYTG-DIGPTCT 277 P C DE+E QC CKSC+ AP P + +C D Y G D GP CT Sbjct: 79 PPQWRCNDELEPSQCTAACKSCREAPGPFPGKLICEDIYWGADPGPFCT 127 Score = 39.7 bits (91), Expect = 0.003 Identities = 22/49 (44%), Positives = 26/49 (53%), Gaps = 4/49 (8%) Frame = -3 Query: 411 PRACXCLDEVEQCAPTCKSCQLAPS---DPSRHVCNDRY-TGDIGPTCT 277 P C DEV+QCA CK C AP + VC+D + T D GP CT Sbjct: 4 PPLYRCNDEVKQCAAACKECVEAPGGDFNGGAFVCSDWFSTVDPGPKCT 52
>IBB1_COILA (P07679) Bowman-Birk type trypsin inhibitor TI1| Length = 64 Score = 60.5 bits (145), Expect = 2e-09 Identities = 23/50 (46%), Positives = 35/50 (70%) Frame = -3 Query: 429 VCYRALPRACXCLDEVEQCAPTCKSCQLAPSDPSRHVCNDRYTGDIGPTC 280 +C R++P C C+D+V++C+ CK C+ ++ +RHVC D Y GD GPTC Sbjct: 14 MCTRSIPPICRCVDKVDRCSDACKDCE--ETEDNRHVCFDTYIGDPGPTC 61
>IBB2_WHEAT (P09864) Bowman-Birk type proteinase inhibitor II-4 (Fragment)| Length = 53 Score = 56.6 bits (135), Expect = 3e-08 Identities = 23/42 (54%), Positives = 27/42 (64%) Frame = -3 Query: 429 VCYRALPRACXCLDEVEQCAPTCKSCQLAPSDPSRHVCNDRY 304 +C ++ P C C+D VEQCA TCK C A SD SR VC D Y Sbjct: 12 ICTKSFPPMCRCMDMVEQCAATCKKCGPATSDSSRRVCEDXY 53
>IBB1_WHEAT (P09863) Bowman-Birk type proteinase inhibitor I-2B (Fragment)| Length = 56 Score = 55.5 bits (132), Expect = 6e-08 Identities = 21/42 (50%), Positives = 29/42 (69%) Frame = -3 Query: 429 VCYRALPRACXCLDEVEQCAPTCKSCQLAPSDPSRHVCNDRY 304 VC R++P C C+D+V +C TCK+C + DPSR VC D+Y Sbjct: 14 VCTRSIPPICRCMDQVFECPSTCKACGPSVGDPSRRVCQDQY 55
>IBB3_SETIT (P22737) Bowman-Birk type trypsin inhibitor 3 (Bowman-Birk type| trypsin inhibitor III) (FMTI-III) Length = 67 Score = 53.5 bits (127), Expect = 2e-07 Identities = 22/52 (42%), Positives = 31/52 (59%), Gaps = 1/52 (1%) Frame = -3 Query: 426 CYRALPRACXCLDEVEQCAPTCKSC-QLAPSDPSRHVCNDRYTGDIGPTCTE 274 C +++P C C D +EQC+ CK C ++ SDP R++C D Y G P C E Sbjct: 14 CTKSIPAFCRCRDLLEQCSDACKECGKVRDSDPPRYICQDVYRGIPAPMCHE 65
>IBB2_SETIT (P19860) Bowman-Birk type major trypsin inhibitor (FMTI-II)| Length = 67 Score = 53.5 bits (127), Expect = 2e-07 Identities = 22/52 (42%), Positives = 31/52 (59%), Gaps = 1/52 (1%) Frame = -3 Query: 426 CYRALPRACXCLDEVEQCAPTCKSC-QLAPSDPSRHVCNDRYTGDIGPTCTE 274 C +++P C C D +EQC+ CK C ++ SDP R++C D Y G P C E Sbjct: 14 CTKSIPAFCRCRDLLEQCSDACKECGKVRDSDPPRYICQDVYRGIPAPMCHE 65
>IBB_MEDSC (P80321) Bowman-Birk type proteinase inhibitor (MSTI)| Length = 62 Score = 38.5 bits (88), Expect = 0.007 Identities = 20/53 (37%), Positives = 26/53 (49%) Frame = -3 Query: 435 FGVCYRALPRACXCLDEVEQCAPTCKSCQLAPSDPSRHVCNDRYTGDIGPTCT 277 F C R++P C C D E+C CKSC S P + C D T P+C+ Sbjct: 11 FCPCTRSIPPQCQCTDVREKCHSACKSCLCTRSFPPQCRCYD-ITDFCYPSCS 62
>IBB_LENCU (Q8W4Y8) Bowman-Birk type proteinase inhibitor precursor| (Trypsin/chymotrypsin inhibitor) Length = 110 Score = 36.6 bits (83), Expect = 0.028 Identities = 15/42 (35%), Positives = 21/42 (50%) Frame = -3 Query: 429 VCYRALPRACXCLDEVEQCAPTCKSCQLAPSDPSRHVCNDRY 304 +C R+ P C C+D E C C C A S+P + C D + Sbjct: 55 LCTRSQPPTCRCVDVRESCHSACDKCVCAYSNPPQCQCYDTH 96
>IBB_PHALU (P01056) Bowman-Birk type proteinase inhibitor| Length = 83 Score = 36.2 bits (82), Expect = 0.036 Identities = 14/40 (35%), Positives = 23/40 (57%), Gaps = 1/40 (2%) Frame = -3 Query: 426 CYRALPRACXCLD-EVEQCAPTCKSCQLAPSDPSRHVCND 310 C +++P C C D ++ C CKSC S P++ VC++ Sbjct: 24 CTKSIPPQCRCTDLRLDSCHSACKSCICTLSIPAQCVCBB 63
>IBBWT_MEDSA (P16346) Bowman-Birk type wound-induced trypsin inhibitor| Length = 58 Score = 35.8 bits (81), Expect = 0.047 Identities = 16/42 (38%), Positives = 20/42 (47%) Frame = -3 Query: 435 FGVCYRALPRACXCLDEVEQCAPTCKSCQLAPSDPSRHVCND 310 F C R++P C C D E C CK+C S P + C D Sbjct: 7 FCPCTRSIPPQCRCTDIGETCHSACKTCLCTKSIPPQCHCAD 48
>IBBA_PEA (Q41065) Seed trypsin/chymotrypsin inhibitor IVA precursor (PSTI| IVA) (TI12-36) [Contains: Seed trypsin/chymotrypsin inhibitor I (PSTI I)] (Fragment) Length = 96 Score = 35.8 bits (81), Expect = 0.047 Identities = 15/42 (35%), Positives = 22/42 (52%) Frame = -3 Query: 429 VCYRALPRACXCLDEVEQCAPTCKSCQLAPSDPSRHVCNDRY 304 +C ++ P C C+D E C C SC A S+P + C D + Sbjct: 37 LCTKSNPPTCRCVDVRETCHSACDSCICAYSNPPKCQCFDTH 78
>IBB_VICFA (P24661) Bowman-Birk type proteinase inhibitor (FBI)| Length = 63 Score = 35.4 bits (80), Expect = 0.062 Identities = 14/42 (33%), Positives = 22/42 (52%) Frame = -3 Query: 429 VCYRALPRACXCLDEVEQCAPTCKSCQLAPSDPSRHVCNDRY 304 +C ++ P C C+D E+C C SC S+P + C D + Sbjct: 13 LCTKSEPPTCRCVDVGERCHSACNSCVCRYSNPPKCQCFDTH 54
>IBBB_PEA (P56679) Seed trypsin/chymotrypsin inhibitor IVB (PSTI-IVB)| [Contains: Seed trypsin/chymotrypsin inhibitor II (PSTI II)] Length = 72 Score = 35.0 bits (79), Expect = 0.081 Identities = 15/40 (37%), Positives = 21/40 (52%) Frame = -3 Query: 429 VCYRALPRACXCLDEVEQCAPTCKSCQLAPSDPSRHVCND 310 +C ++ P C C+D E C C SC A S+P + C D Sbjct: 13 LCTKSNPPTCRCVDVGETCHSACLSCICAYSNPPKCQCFD 52
>IBB4_DOLAX (P01059) Bowman-Birk type proteinase inhibitor DE-4| Length = 76 Score = 34.7 bits (78), Expect = 0.11 Identities = 15/40 (37%), Positives = 22/40 (55%), Gaps = 1/40 (2%) Frame = -3 Query: 426 CYRALPRACXCLD-EVEQCAPTCKSCQLAPSDPSRHVCND 310 C +++P C C D + C CKSC A S+P++ C D Sbjct: 21 CTKSIPPQCHCNDMRLNSCHSACKSCICALSEPAQCFCVD 60
>IBB_VICAN (P01065) Bowman-Birk type proteinase inhibitor (VAI)| Length = 72 Score = 34.3 bits (77), Expect = 0.14 Identities = 14/42 (33%), Positives = 21/42 (50%) Frame = -3 Query: 429 VCYRALPRACXCLDEVEQCAPTCKSCQLAPSDPSRHVCNDRY 304 +C R+ P C C+D E+C C C S+P + C D + Sbjct: 13 LCTRSQPPTCRCVDVGERCHSACNHCVCNYSNPPQCQCFDTH 54
>IBBD2_SOYBN (P01064) Bowman-Birk type proteinase inhibitor D-II precursor (IV)| Length = 83 Score = 34.3 bits (77), Expect = 0.14 Identities = 15/41 (36%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = -3 Query: 429 VCYRALPRACXCLD-EVEQCAPTCKSCQLAPSDPSRHVCND 310 +C R++P C C D + C CKSC S P + C D Sbjct: 29 MCTRSMPPQCSCEDIRLNSCHSDCKSCMCTRSQPGQCRCLD 69 Score = 28.1 bits (61), Expect = 9.9 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = -3 Query: 429 VCYRALPRACXCLDEVEQCAPTCKS 355 +C R+ P C CLD + C CKS Sbjct: 56 MCTRSQPGQCRCLDTNDFCYKPCKS 80
>IBB4_LONCA (P16343) Bowman-Birk type proteinase inhibitor DE-4 (DE4)| Length = 80 Score = 34.3 bits (77), Expect = 0.14 Identities = 16/40 (40%), Positives = 18/40 (45%), Gaps = 1/40 (2%) Frame = -3 Query: 426 CYRALPRACXCLD-EVEQCAPTCKSCQLAPSDPSRHVCND 310 C R+ P C C D + C CKSC SDP C D Sbjct: 23 CTRSRPPQCQCTDVRLNSCHSACKSCMCTFSDPGMCSCLD 62
>IBB2_PHAAN (P01061) Bowman-Birk type proteinase inhibitors I-A, I-B, and I-A'| Length = 78 Score = 33.9 bits (76), Expect = 0.18 Identities = 14/43 (32%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = -3 Query: 429 VCYRALPRACXCLD-EVEQCAPTCKSCQLAPSDPSRHVCNDRY 304 +C +++P C C D ++ C CKSC S P + C D + Sbjct: 23 LCTKSIPPQCQCADIRLDSCHSACKSCMCTRSMPGQCRCLDTH 65 Score = 29.6 bits (65), Expect = 3.4 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -3 Query: 429 VCYRALPRACXCLDEVEQCAPTCKS 355 +C R++P C CLD + C CKS Sbjct: 50 MCTRSMPGQCRCLDTHDFCHKPCKS 74
>IBB1_PHAAN (P01058) Bowman-Birk type proteinase inhibitor| Length = 82 Score = 33.9 bits (76), Expect = 0.18 Identities = 14/40 (35%), Positives = 20/40 (50%), Gaps = 1/40 (2%) Frame = -3 Query: 426 CYRALPRACXCLD-EVEQCAPTCKSCQLAPSDPSRHVCND 310 C +++P C C D + C CKSC S P++ C D Sbjct: 24 CTKSMPPKCRCSDIRLNSCHSACKSCACTYSIPAKCFCTD 63
>IBB1_ARAHY (P01066) Bowman-Birk type proteinase inhibitor A-II [Contains:| Bowman-Birk type proteinase inhibitor A-I; Bowman-Birk type proteinase inhibitor B-I; Bowman-Birk type proteinase inhibitor B-III] Length = 70 Score = 33.9 bits (76), Expect = 0.18 Identities = 15/46 (32%), Positives = 22/46 (47%), Gaps = 2/46 (4%) Frame = -3 Query: 429 VCYRALPR--ACXCLDEVEQCAPTCKSCQLAPSDPSRHVCNDRYTG 298 +C R P C C+D + C +C SC S+P + C D+ G Sbjct: 16 LCDRRAPPYFECVCVDTFDHCPASCNSCVCTRSNPPQCRCTDKTQG 61
>IBB2_PEA (Q41066) Seed trypsin/chymotrypsin inhibitor TI5-72 precursor| Length = 114 Score = 33.5 bits (75), Expect = 0.24 Identities = 15/42 (35%), Positives = 21/42 (50%) Frame = -3 Query: 429 VCYRALPRACXCLDEVEQCAPTCKSCQLAPSDPSRHVCNDRY 304 +C ++ P C C+D E C C SC A S P + C D + Sbjct: 55 LCTKSDPPTCRCVDVGETCHSACDSCICALSYPPQCQCFDTH 96
>IBB_ERYVA (P81705) Bowman-Birk type proteinase inhibitor (EBI)| Length = 61 Score = 33.5 bits (75), Expect = 0.24 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = -3 Query: 426 CYRALPRACXCLDEVEQCAPTCKSCQLAPSDPSRHVCNDRYT 301 C ++ P C C D E C CK C A S P++ C D+ T Sbjct: 10 CTKSNPPICQCRDVGETCHSACKFCICALSYPAQCHCLDQNT 51
>IBB_DOLBI (Q9S9E3) Horsegram inhibitor 1 (Horsegram inhibitor I) (Bowman-Birk| type proteinase inhibitor HGI-I) [Contains: Horsegram germinated inhibitor 1 (Horsegram germinated inhibitor I) (HGGI-I); Horsegram germinated inhibitor 2 (Horsegram germinated Length = 76 Score = 32.0 bits (71), Expect = 0.68 Identities = 14/40 (35%), Positives = 20/40 (50%), Gaps = 1/40 (2%) Frame = -3 Query: 426 CYRALPRACXCLD-EVEQCAPTCKSCQLAPSDPSRHVCND 310 C +++P C C D + C C SC S P++ VC D Sbjct: 22 CTKSIPPQCRCTDVRLNSCHSACSSCVCTFSIPAQCVCVD 61
>IBB3_WHEAT (P81713) Bowman-Birk type trypsin inhibitor (WTI)| Length = 71 Score = 32.0 bits (71), Expect = 0.68 Identities = 12/28 (42%), Positives = 15/28 (53%), Gaps = 1/28 (3%) Frame = -3 Query: 432 GVCYRALPRACXCLD-EVEQCAPTCKSC 352 G C R +P C C+D C P CK+C Sbjct: 15 GTCTRMIPPRCTCMDVSPSGCHPACKNC 42
>IBB3_DOLAX (P01057) Bowman-Birk type proteinase inhibitor DE-3| Length = 76 Score = 32.0 bits (71), Expect = 0.68 Identities = 14/40 (35%), Positives = 20/40 (50%), Gaps = 1/40 (2%) Frame = -3 Query: 426 CYRALPRACXCLD-EVEQCAPTCKSCQLAPSDPSRHVCND 310 C +++P C C D + C C SC S P++ VC D Sbjct: 22 CTKSIPPQCRCTDVRLNSCHSACSSCVCTFSIPAQCVCVD 61
>IBB2_PHAVU (P01060) Bowman-Birk type proteinase inhibitor 2 (Bowman-Birk type| proteinase inhibitor II) Length = 79 Score = 32.0 bits (71), Expect = 0.68 Identities = 13/41 (31%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = -3 Query: 429 VCYRALPRACXCLD-EVEQCAPTCKSCQLAPSDPSRHVCND 310 VC ++P C C + ++ C CKSC S P + C + Sbjct: 22 VCTASIPPQCVCTBIRLBSCHSACKSCMCTRSMPGKCRCLB 62 Score = 31.2 bits (69), Expect = 1.2 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = -3 Query: 429 VCYRALPRACXCLDEVEQCAPTCKS 355 +C R++P C CL+ + C +CKS Sbjct: 49 MCTRSMPGKCRCLBTTBYCYKSCKS 73
>IBBWP_MAIZE (P31862) Bowman-Birk type wound-induced proteinase inhibitor WIP1| precursor Length = 102 Score = 31.6 bits (70), Expect = 0.89 Identities = 15/43 (34%), Positives = 20/43 (46%), Gaps = 4/43 (9%) Frame = -3 Query: 396 CLDEVEQCAPTCKSCQLAP----SDPSRHVCNDRYTGDIGPTC 280 C D + C P CK C +A S ++ C D + G GP C Sbjct: 60 CDDVKKDCDPVCKKCVVAVHASYSGNNKFRCTDTFLGMCGPKC 102
>RUVC_TREPA (O83530) Crossover junction endodeoxyribonuclease ruvC (EC| 3.1.22.4) (Holliday junction nuclease ruvC) (Holliday juction resolvase ruvC) Length = 196 Score = 31.6 bits (70), Expect = 0.89 Identities = 23/76 (30%), Positives = 36/76 (47%), Gaps = 14/76 (18%) Frame = -3 Query: 297 DIGPTCTETVAAAI-LNYGAQGTGQDA-------------QVIVAGGN*PACALIRHLIN 160 DI P T TV+ + ++ G + TG VIV N P+ A +RH+ + Sbjct: 7 DIAPGSTSTVSIIVGIDPGLESTGYGVIEAGGGSLRCLTYGVIVTQSNQPSAARLRHIFD 66 Query: 159 AVQPELESLQQPAVCA 112 +Q ++ S+ QP CA Sbjct: 67 TLQ-QVISIYQPQYCA 81
>IBB4_PHAVU (P81483) Bowman-Birk type proteinase inhibitor PVI-4| Length = 85 Score = 31.2 bits (69), Expect = 1.2 Identities = 12/40 (30%), Positives = 20/40 (50%), Gaps = 1/40 (2%) Frame = -3 Query: 426 CYRALPRACXCLD-EVEQCAPTCKSCQLAPSDPSRHVCND 310 C +++P C C + + C CK C S P++ +C D Sbjct: 28 CTKSIPPQCRCSBLRLNSCHSECKGCICTFSIPAQCICTD 67
>IBB3_PHAVU (P81484) Bowman-Birk type proteinase inhibitor PVI-3(2)| Length = 85 Score = 31.2 bits (69), Expect = 1.2 Identities = 12/40 (30%), Positives = 20/40 (50%), Gaps = 1/40 (2%) Frame = -3 Query: 426 CYRALPRACXCLD-EVEQCAPTCKSCQLAPSDPSRHVCND 310 C +++P C C + + C CK C S P++ +C D Sbjct: 27 CTKSIPPQCRCSBLRLNSCHSECKGCICTFSIPAQCICTD 66
>IBB1_AMBAC (P83284) Bowman-birk type proteinase inhibitor (TaTI)| Length = 63 Score = 31.2 bits (69), Expect = 1.2 Identities = 13/40 (32%), Positives = 20/40 (50%), Gaps = 1/40 (2%) Frame = -3 Query: 426 CYRALPRACXCLD-EVEQCAPTCKSCQLAPSDPSRHVCND 310 C +++P C C D + C C+SC S P++ C D Sbjct: 13 CTKSIPPQCHCADIRLNSCHSACESCACTRSIPAKCRCFD 52
>IBB1_SOYBN (P01055) Bowman-Birk type proteinase inhibitor precursor (BBI)| Length = 110 Score = 31.2 bits (69), Expect = 1.2 Identities = 15/40 (37%), Positives = 20/40 (50%), Gaps = 1/40 (2%) Frame = -3 Query: 426 CYRALPRACXCLD-EVEQCAPTCKSCQLAPSDPSRHVCND 310 C ++ P C C D + C CKSC A S P++ C D Sbjct: 53 CTKSNPPQCRCSDMRLNSCHSACKSCICALSYPAQCFCVD 92
>IBB2_ARAHY (P01067) Bowman-Birk type proteinase inhibitor B-II| Length = 63 Score = 30.8 bits (68), Expect = 1.5 Identities = 15/46 (32%), Positives = 18/46 (39%), Gaps = 2/46 (4%) Frame = -3 Query: 429 VCYRALPR--ACXCLDEVEQCAPTCKSCQLAPSDPSRHVCNDRYTG 298 +C R P C C D + C C C S P + C DR G Sbjct: 10 ICDRRAPPYFECTCGDTFDHCPAACNKCVCTRSIPPQCRCTDRTQG 55
>IBB2_AMBCE (P83283) Bowman-birk type proteinase inhibitor 2 (TcTI2)| Length = 63 Score = 30.8 bits (68), Expect = 1.5 Identities = 13/40 (32%), Positives = 20/40 (50%), Gaps = 1/40 (2%) Frame = -3 Query: 426 CYRALPRACXCLD-EVEQCAPTCKSCQLAPSDPSRHVCND 310 C +++P C C D + C C+SC S P++ C D Sbjct: 13 CTKSIPPQCHCADIRLNSCHSACESCACTHSIPAQCRCFD 52
>IBBC2_SOYBN (P01063) Bowman-Birk type proteinase inhibitor C-II precursor| Length = 83 Score = 30.4 bits (67), Expect = 2.0 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = -3 Query: 426 CYRALPRACXCLDEVEQCAPTCKS 355 C R++P C CLD + C CKS Sbjct: 54 CTRSMPGQCRCLDTTDFCYKPCKS 77
>CFTR_MICMU (Q2QL83) Cystic fibrosis transmembrane conductance regulator (CFTR)| (cAMP-dependent chloride channel) (ATP-binding cassette transporter sub-family C member 7) Length = 1481 Score = 30.4 bits (67), Expect = 2.0 Identities = 19/62 (30%), Positives = 32/62 (51%), Gaps = 5/62 (8%) Frame = +1 Query: 262 GGNSLRARGPYIAGVPVVADMTGWIGRXQLAAL-----AGRSTLLDLVKAXARPRKRTVA 426 G NSL + G PV+ D++ I R QL A+ AG+++LL ++ P + + Sbjct: 424 GDNSLFFSNLALLGTPVLKDISFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIK 483 Query: 427 HT 432 H+ Sbjct: 484 HS 485
>IBB_VIGUN (P17734) Bowman-Birk type seed trypsin and chymotrypsin inhibitor| (BTCI) Length = 83 Score = 30.0 bits (66), Expect = 2.6 Identities = 12/40 (30%), Positives = 19/40 (47%), Gaps = 1/40 (2%) Frame = -3 Query: 426 CYRALPRACXCLD-EVEQCAPTCKSCQLAPSDPSRHVCND 310 C +++P C C + + C CKSC S P+ C + Sbjct: 24 CTKSIPPZCRCSZVRLNSCHSACKSCACTFSIPAZCFCGB 63
>CFTR_HORSE (Q2QLA3) Cystic fibrosis transmembrane conductance regulator (CFTR)| (cAMP-dependent chloride channel) (ATP-binding cassette transporter sub-family C member 7) Length = 1481 Score = 30.0 bits (66), Expect = 2.6 Identities = 19/62 (30%), Positives = 32/62 (51%), Gaps = 5/62 (8%) Frame = +1 Query: 262 GGNSLRARGPYIAGVPVVADMTGWIGRXQLAAL-----AGRSTLLDLVKAXARPRKRTVA 426 G NSL + G PV+ D++ I R QL A+ AG+++LL ++ P + + Sbjct: 423 GDNSLFFSNFSLLGTPVLKDISFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIK 482 Query: 427 HT 432 H+ Sbjct: 483 HS 484
>CRUM2_HUMAN (Q5IJ48) Crumbs homolog 2 precursor (Crumbs-like protein 2)| Length = 1285 Score = 30.0 bits (66), Expect = 2.6 Identities = 34/115 (29%), Positives = 42/115 (36%), Gaps = 19/115 (16%) Frame = -3 Query: 396 CLDEVEQCAPT-CKS---CQLAPSDPSRHVCNDRYTGDI---------------GPTCTE 274 C EV++CA C + CQ P+ H C D Y G G TC++ Sbjct: 317 CGVEVDECASRPCLNGGHCQDLPNGFQCH-CPDGYAGPTCEEDVDECLSDPCLHGGTCSD 375 Query: 273 TVAAAILNYGAQGTGQDAQVIVAGGN*PACALIRHLINAVQPELESLQQPAVCAC 109 TVA I G+D V + G C L I P ES VC C Sbjct: 376 TVAGYICRCPETWGGRDCSVQLTGCQGHTCPLAATCI----PIFESGVHSYVCHC 426
>MCSP_RAT (Q64298) Sperm mitochondrial-associated cysteine-rich protein| Length = 145 Score = 30.0 bits (66), Expect = 2.6 Identities = 19/69 (27%), Positives = 26/69 (37%), Gaps = 1/69 (1%) Frame = -3 Query: 426 CYRALPRACXCLDEVEQCAPT-CKSCQLAPSDPSRHVCNDRYTGDIGPTCTETVAAAILN 250 C P AC C ++ C PT C C P + C + T + PTC + + Sbjct: 61 CPATCPAACACPCPMKPCCPTKCTCC------PKKCTCCPQPTCCVQPTCCSSENKTESD 114 Query: 249 YGAQGTGQD 223 G QD Sbjct: 115 SDGSGQTQD 123
>CFTR_PIG (Q6PQZ2) Cystic fibrosis transmembrane conductance regulator (CFTR)| (cAMP-dependent chloride channel) (ATP-binding cassette transporter sub-family C member 7) Length = 1482 Score = 30.0 bits (66), Expect = 2.6 Identities = 19/62 (30%), Positives = 32/62 (51%), Gaps = 5/62 (8%) Frame = +1 Query: 262 GGNSLRARGPYIAGVPVVADMTGWIGRXQLAAL-----AGRSTLLDLVKAXARPRKRTVA 426 G NSL + G PV+ D++ I R QL A+ AG+++LL ++ P + + Sbjct: 424 GDNSLFFSNFSLLGTPVLKDISFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIK 483 Query: 427 HT 432 H+ Sbjct: 484 HS 485
>IBB_PHAAU (P01062) Bowman-Birk type trypsin inhibitor| Length = 72 Score = 29.6 bits (65), Expect = 3.4 Identities = 13/40 (32%), Positives = 19/40 (47%), Gaps = 1/40 (2%) Frame = -3 Query: 426 CYRALPRACXCLD-EVEQCAPTCKSCQLAPSDPSRHVCND 310 C +++P C C + + C CKSC S P + C D Sbjct: 18 CTKSIPPECHCANIRLNSCHSACKSCICTRSMPGKCRCLD 57 Score = 28.9 bits (63), Expect = 5.8 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = -3 Query: 429 VCYRALPRACXCLDEVEQCAPTCKS 355 +C R++P C CLD + C C+S Sbjct: 44 ICTRSMPGKCRCLDTDDFCYKPCES 68
>KITH_BACFR (Q64YL9) Thymidine kinase (EC 2.7.1.21)| Length = 199 Score = 29.6 bits (65), Expect = 3.4 Identities = 19/64 (29%), Positives = 24/64 (37%), Gaps = 5/64 (7%) Frame = -3 Query: 432 GVCYRALPRACXCLDEVEQCAPTCKSCQLAPSDPSRHVCNDRY-----TGDIGPTCTETV 268 GV + +P C DEV + C C S R V ND+ T P C E Sbjct: 129 GVPFGPMPALCAIADEVSKVHAICVKCGQLASFSHRTVKNDKQVLLGETAQYEPLCRECY 188 Query: 267 AAAI 256 A+ Sbjct: 189 QRAL 192
>CFTR_CANFA (Q5U820) Cystic fibrosis transmembrane conductance regulator (CFTR)| (cAMP-dependent chloride channel) (ATP-binding cassette transporter sub-family C member 7) Length = 1483 Score = 29.6 bits (65), Expect = 3.4 Identities = 19/62 (30%), Positives = 31/62 (50%), Gaps = 5/62 (8%) Frame = +1 Query: 262 GGNSLRARGPYIAGVPVVADMTGWIGRXQLAAL-----AGRSTLLDLVKAXARPRKRTVA 426 G NSL + G PV+ D+ I R QL A+ AG+++LL ++ P + + Sbjct: 424 GDNSLFFSNFSLLGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIK 483 Query: 427 HT 432 H+ Sbjct: 484 HS 485
>PGBM_HUMAN (P98160) Basement membrane-specific heparan sulfate proteoglycan core| protein precursor (HSPG) (Perlecan) (PLC) Length = 4391 Score = 29.3 bits (64), Expect = 4.4 Identities = 33/123 (26%), Positives = 39/123 (31%), Gaps = 3/123 (2%) Frame = -3 Query: 432 GVCYRALPRACXCLDEVEQCAPT---CKSCQLAPSDPSRHVCNDRYTGDIGPTCTETVAA 262 G C R C C E C P C+ CQ P C Y GD Sbjct: 1154 GTCER-----CSCHGHSEACEPETGACQGCQHHTEGPRCEQCQPGYYGD----------- 1197 Query: 261 AILNYGAQGTGQDAQVIVAGGN*PACALIRHLINAVQPELESLQQPAVCACKQ*NKNGSS 82 +GT QD Q+ G+ PA H L++ P AC G S Sbjct: 1198 -----AQRGTPQDCQLCPCYGD-PAAGQAAHTC-----FLDTDGHPTCDACSP----GHS 1242 Query: 81 GSH 73 G H Sbjct: 1243 GRH 1245
>TILS_LEPIN (Q8F9P6) tRNA(Ile)-lysidine synthase (EC 6.3.4.-)| (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) Length = 433 Score = 29.3 bits (64), Expect = 4.4 Identities = 16/43 (37%), Positives = 25/43 (58%) Frame = +1 Query: 166 QVPDQRASWLVTAGHNHLGVLTSTLGSIVEYGGGNSLRARGPY 294 ++ DQ ++VT GH+ L + L +++ GG NSLR G Y Sbjct: 124 KISDQYEGYIVT-GHHSSDYLETILLNLIRGGGWNSLRTLGWY 165
>TILS_LEPIC (Q72W10) tRNA(Ile)-lysidine synthase (EC 6.3.4.-)| (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) Length = 433 Score = 29.3 bits (64), Expect = 4.4 Identities = 16/43 (37%), Positives = 25/43 (58%) Frame = +1 Query: 166 QVPDQRASWLVTAGHNHLGVLTSTLGSIVEYGGGNSLRARGPY 294 ++ DQ ++VT GH+ L + L +++ GG NSLR G Y Sbjct: 124 KISDQYEGYIVT-GHHSSDYLETILLNLIRGGGWNSLRTLGWY 165
>KITH_BACFN (Q5LHP5) Thymidine kinase (EC 2.7.1.21)| Length = 199 Score = 29.3 bits (64), Expect = 4.4 Identities = 18/64 (28%), Positives = 24/64 (37%), Gaps = 5/64 (7%) Frame = -3 Query: 432 GVCYRALPRACXCLDEVEQCAPTCKSCQLAPSDPSRHVCNDRY-----TGDIGPTCTETV 268 G+ + +P C DEV + C C S R V ND+ T P C E Sbjct: 129 GIPFGPMPALCAIADEVSKVHAICVKCGQLASFSHRTVKNDKQVLLGETAQYEPLCRECY 188 Query: 267 AAAI 256 A+ Sbjct: 189 QRAL 192
>IBB1_DIOGL (P82469) Bowman-Birk type proteinase inhibitor 1 (Bowman-Birk type| proteinase inhibitor I) (DgTI) Length = 67 Score = 28.9 bits (63), Expect = 5.8 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = -3 Query: 429 VCYRALPRACXCLDEVEQCAPTCKS 355 VC ++P C CLD C CKS Sbjct: 37 VCSHSMPGLCSCLDITHFCHEPCKS 61
>POLG_FMDVS (P03311) Genome polyprotein [Contains: Coat protein VP3; Coat| protein VP1; Core protein p52; Protease (EC 3.4.22.-); RNA-directed RNA polymerase (EC 2.7.7.48)] (Fragments) Length = 861 Score = 28.9 bits (63), Expect = 5.8 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = -3 Query: 327 RHVCNDRYTGDIGPTCTETVAAAILNYGAQGTGQDAQVIVAG 202 RH D TG P T AIL++ +GT Q+ + VAG Sbjct: 779 RHFHMDYGTGFYKPVMTSKTLEAILSFARRGTIQEKLISVAG 820
>BTNL2_HUMAN (Q9UIR0) Butyrophilin-like protein 2 precursor (BTL-II)| Length = 455 Score = 28.5 bits (62), Expect = 7.6 Identities = 20/69 (28%), Positives = 29/69 (42%) Frame = +1 Query: 145 LRLHCVDQVPDQRASWLVTAGHNHLGVLTSTLGSIVEYGGGNSLRARGPYIAGVPVVADM 324 L++H + Q D W N+ G TS L + G S+ GP +GV +V Sbjct: 109 LKIHNI-QPSDNGQYWCHFQDGNYCGE-TSLLLKVAGLGSAPSIHMEGPGESGVQLVCTA 166 Query: 325 TGWIGRXQL 351 GW Q+ Sbjct: 167 RGWFPEPQV 175
>PGBM_MOUSE (Q05793) Basement membrane-specific heparan sulfate proteoglycan core| protein precursor (HSPG) (Perlecan) (PLC) Length = 3707 Score = 28.5 bits (62), Expect = 7.6 Identities = 24/74 (32%), Positives = 25/74 (33%), Gaps = 3/74 (4%) Frame = -3 Query: 432 GVCYRALPRACXCLDEVEQCAPT---CKSCQLAPSDPSRHVCNDRYTGDIGPTCTETVAA 262 G C R C C E C P C+SCQ S C Y GD T Sbjct: 1154 GTCER-----CNCHGHSETCEPETGACQSCQHHTEGASCEQCQPGYYGD-AQRGTPQDCQ 1207 Query: 261 AILNYGAQGTGQDA 220 YGA GQ A Sbjct: 1208 PCPCYGAPAAGQAA 1221
>LRP1_HUMAN (Q07954) Low-density lipoprotein receptor-related protein 1 precursor| (LRP) (Alpha-2-macroglobulin receptor) (A2MR) (Apolipoprotein E receptor) (APOER) (CD91 antigen) Length = 4544 Score = 28.5 bits (62), Expect = 7.6 Identities = 22/79 (27%), Positives = 30/79 (37%) Frame = -3 Query: 420 RALPRACXCLDEVEQCAPTCKSCQLAPSDPSRHVCNDRYTGDIGPTCTETVAAAILNYGA 241 R PR E++QC C++ + PS TG GP CT+ V A Sbjct: 4221 RCQPRYTGDKCELDQCWEHCRNGGTCAASPSGMPTCRCPTGFTGPKCTQQVCAGY----- 4275 Query: 240 QGTGQDAQVIVAGGN*PAC 184 ++ V GN P C Sbjct: 4276 --CANNSTCTVNQGNQPQC 4292
>IGF1R_XENLA (O73798) Insulin-like growth factor 1 receptor precursor (EC| 2.7.10.1) (xIGF-1R) (xIGFR) [Contains: Insulin-like growth factor 1 receptor alpha chain; Insulin-like growth factor 1 receptor beta chain] Length = 1358 Score = 28.5 bits (62), Expect = 7.6 Identities = 18/54 (33%), Positives = 22/54 (40%), Gaps = 5/54 (9%) Frame = -3 Query: 426 CYRALPRAC---XCLDEVEQCAPTC-KSCQLAPSDPSRHVCNDR-YTGDIGPTC 280 C + P C C D E C P C SC +D + C+ Y G PTC Sbjct: 208 CQKVCPSVCGKRACSDNNECCHPECLGSCTAPDNDTACVACHHYFYEGRCVPTC 261
>NAS27_CAEEL (O17264) Zinc metalloproteinase nas-27 precursor (EC 3.4.24.21)| (Nematode astacin 27) Length = 428 Score = 28.1 bits (61), Expect = 9.9 Identities = 16/37 (43%), Positives = 20/37 (54%), Gaps = 4/37 (10%) Frame = -3 Query: 381 EQCAPTCKSCQL----APSDPSRHVCNDRYTGDIGPT 283 E+CA T CQ APSD S+ VC D + G+ T Sbjct: 256 ERCANTLNRCQQGGYPAPSDCSQCVCPDGFGGNFCET 292
>LCE1F_HUMAN (Q5T754) Late cornified envelope protein 1F (Late envelope protein| 6) Length = 118 Score = 28.1 bits (61), Expect = 9.9 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = +2 Query: 80 PELPFLFYCLHAHTAGCCSDSSSGC 154 P+ P + C + GCC SS GC Sbjct: 35 PKCPPVSSCCSVSSGGCCGSSSGGC 59 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 62,739,939 Number of Sequences: 219361 Number of extensions: 1292825 Number of successful extensions: 3528 Number of sequences better than 10.0: 57 Number of HSP's better than 10.0 without gapping: 3333 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3517 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2570413340 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)