| Clone Name | rbags28f14 |
|---|---|
| Clone Library Name | barley_pub |
>SYFB_DEIRA (Q9RRX5) Phenylalanyl-tRNA synthetase beta chain (EC 6.1.1.20)| (Phenylalanine--tRNA ligase beta chain) (PheRS) Length = 820 Score = 30.0 bits (66), Expect = 2.8 Identities = 15/45 (33%), Positives = 21/45 (46%) Frame = +2 Query: 239 GPPQVPSTVLFMSAQRNVL*GLGVTTRQAEQPLGHLGWAVVADVD 373 G P+VP T+ Q L G+ + T + + L LG V D D Sbjct: 432 GTPEVPQTITTTGEQIRALLGMHIGTAEMRESLTRLGCTVTGDGD 476
>RUVB_GLUOX (Q5FQC4) Holliday junction ATP-dependent DNA helicase ruvB (EC| 3.6.1.-) Length = 349 Score = 28.9 bits (63), Expect = 6.3 Identities = 17/54 (31%), Positives = 25/54 (46%) Frame = +2 Query: 221 DQCFLHGPPQVPSTVLFMSAQRNVL*GLGVTTRQAEQPLGHLGWAVVADVDPRE 382 D LHGPP + T L R + G T+ Q G L A++ ++ PR+ Sbjct: 55 DHVLLHGPPGLGKTTLAQIVARELGVGFRATSGPVIQRAGDLA-AILTNLQPRD 107
>PKSJ_BACSU (P40806) Putative polyketide synthase pksJ (PKS)| Length = 5045 Score = 28.5 bits (62), Expect = 8.2 Identities = 15/39 (38%), Positives = 20/39 (51%), Gaps = 2/39 (5%) Frame = +2 Query: 248 QVPSTVLFMSAQRNVL*GL--GVTTRQAEQPLGHLGWAV 358 Q+P T +FMSA N L TT E P G++ W + Sbjct: 1869 QIPQTSVFMSASNNSYRALLPSDTTESLETPDGYVSWVL 1907
>ARHG6_MOUSE (Q8K4I3) Rho guanine nucleotide exchange factor 6 (Rac/Cdc42| guanine nucleotide exchange factor 6) Length = 771 Score = 28.5 bits (62), Expect = 8.2 Identities = 18/43 (41%), Positives = 19/43 (44%), Gaps = 6/43 (13%) Frame = +2 Query: 158 CSSHLSFILGGTPRPSL------KP*SDQCFLHGPPQVPSTVL 268 CS+H SF G PR L KP S C PP PS L Sbjct: 563 CSTHSSFSSTGQPRGPLEPPQIIKPWSLSCLRPAPPLRPSAAL 605
>ARHG6_HUMAN (Q15052) Rho guanine nucleotide exchange factor 6 (Rac/Cdc42| guanine nucleotide exchange factor 6) (PAK-interacting exchange factor alpha) (Alpha-Pix) (COOL-2) Length = 776 Score = 28.5 bits (62), Expect = 8.2 Identities = 18/43 (41%), Positives = 19/43 (44%), Gaps = 6/43 (13%) Frame = +2 Query: 158 CSSHLSFILGGTPRPSL------KP*SDQCFLHGPPQVPSTVL 268 CS+H SF G PR L KP S C PP PS L Sbjct: 564 CSAHSSFSSTGQPRGPLEPPQIIKPWSLSCLRPAPPLRPSAAL 606
>ARHG6_RAT (Q5XXR3) Rho guanine nucleotide exchange factor 6 (Rac/Cdc42| guanine nucleotide exchange factor 6) Length = 772 Score = 28.5 bits (62), Expect = 8.2 Identities = 18/43 (41%), Positives = 19/43 (44%), Gaps = 6/43 (13%) Frame = +2 Query: 158 CSSHLSFILGGTPRPSL------KP*SDQCFLHGPPQVPSTVL 268 CS+H SF G PR L KP S C PP PS L Sbjct: 564 CSTHSSFSSTGQPRGPLEPPQIIKPWSLSCLRPAPPLRPSAAL 606 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 54,786,382 Number of Sequences: 219361 Number of extensions: 1021977 Number of successful extensions: 2398 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2337 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2393 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2793557952 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)