| Clone Name | rbags28e14 |
|---|---|
| Clone Library Name | barley_pub |
>HSF_SCHPO (Q02953) Heat shock factor protein (HSF) (Heat shock transcription| factor) (HSTF) Length = 609 Score = 30.8 bits (68), Expect = 2.6 Identities = 13/43 (30%), Positives = 27/43 (62%) Frame = +2 Query: 245 TEVPALTRNDLPDPIIARSGVLPTSLHTRSSIDRNSVTTMNTL 373 T+VP+L R+D DP + +G + L +SI+ +++ +++ L Sbjct: 357 TDVPSLNRDDTTDPKVVNTGDIINMLDDANSIEGSNMNSLSPL 399
>PAD5_MOUSE (Q68ED3) PAP associated domain-containing 5 (EC 2.7.7.-)| (Topoisomerase-related function protein 4-2) (TRF4-2) Length = 633 Score = 30.8 bits (68), Expect = 2.6 Identities = 18/57 (31%), Positives = 26/57 (45%) Frame = -2 Query: 543 QESSGAGFFESMDGFLGRVETEIGSLKMAERGALQRVKETTQYFHGDGNMEEPSQPL 373 Q S F S GF G +T G+L +++ + K TQY+HG + PL Sbjct: 575 QHGSARLFRSSSKGFQGTAQTSHGALMTSKQ---HQGKSNTQYYHGKKRRHKRDAPL 628
>ROUGH_DROME (P10181) Homeobox protein rough| Length = 350 Score = 29.3 bits (64), Expect = 7.6 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +1 Query: 313 DVPAHAVQYRQELCHHHEHPQRL 381 D P H Q Q+ HHH HP +L Sbjct: 113 DYPQHPSQQHQQHHHHHHHPPQL 135
>NELFE_MOUSE (P19426) Negative elongation factor E (NELF-E) (RD protein)| Length = 375 Score = 29.3 bits (64), Expect = 7.6 Identities = 26/98 (26%), Positives = 45/98 (45%), Gaps = 1/98 (1%) Frame = -2 Query: 516 ESMDGFLGRVETEIGSLKMAERGALQRVKETTQYFHGDGNMEEPSQPLRVFMVVTEFLSI 337 E+ + R T G LK E+G + + + D +++EPS+ + + F+S Sbjct: 80 ETKNSGFKRSRTLEGKLKDPEKGPVPTFQPFQRSMSADEDLQEPSRRPQRKSLYESFVSS 139 Query: 336 LDRVCRDVGRTPERA-MMGSGKSFRVSAGTSVPPRRYD 226 DR+ R++G+ E A G+G PPR +D Sbjct: 140 SDRL-RELGQDGEEAEAPGAGDG---------PPRGFD 167
>UTP20_MOUSE (Q5XG71) Small subunit processome component 20 homolog| (Down-regulated in metastasis protein) Length = 2788 Score = 28.9 bits (63), Expect = 9.9 Identities = 21/56 (37%), Positives = 28/56 (50%) Frame = +1 Query: 298 LRRPADVPAHAVQYRQELCHHHEHPQRLRRLLHVAITMEVLRGLLHTLQRAPLRHL 465 LR+ VPA YR++L H LR+L H + V +G LQ PLR+L Sbjct: 679 LRQAELVPATVSDYREKLLH-------LRKLRHDVVQGAVPQG---RLQEVPLRYL 724
>DPOLM_HUMAN (Q9NP87) DNA polymerase mu (EC 2.7.7.7) (Pol Mu)| Length = 494 Score = 28.9 bits (63), Expect = 9.9 Identities = 24/69 (34%), Positives = 31/69 (44%), Gaps = 2/69 (2%) Frame = +1 Query: 274 LTGPHHRPLRRPADVPAHAVQYRQELCHHHEHPQRLRRLLHVAITMEVLRGLLHTLQRAP 453 + GP PL PA +PA+A Q L HH+ +L A E G L T RA Sbjct: 125 VAGPRKGPLS-PAWMPAYACQRPTPLTHHNTGLSEALEILAEAAGFEGSEGRLLTFCRAA 183 Query: 454 --LRHLQAP 474 L+ L +P Sbjct: 184 SVLKALPSP 192 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 64,910,393 Number of Sequences: 219361 Number of extensions: 1161624 Number of successful extensions: 3942 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 3795 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3937 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4373119116 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)