| Clone Name | rbags28e12 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | YCT3_SCHPO (O59813) Putative amino-acid permease C794.03 | 29 | 5.6 | 2 | K1199_HUMAN (Q8WUJ3) Protein KIAA1199 precursor | 29 | 7.3 | 3 | COBS_METKA (Q8TUT2) Cobalamin synthase (EC 2.-.-.-) | 29 | 7.3 |
|---|
>YCT3_SCHPO (O59813) Putative amino-acid permease C794.03| Length = 554 Score = 29.3 bits (64), Expect = 5.6 Identities = 20/68 (29%), Positives = 33/68 (48%), Gaps = 10/68 (14%) Frame = -2 Query: 478 NLFVCVVLYNVNAFPIT--------VMFGMCSIF--LFMAAILQRRLMVVADLHKLSTKS 329 NLF V+L++ A+P+T V+FG +IF + +I R D KL + S Sbjct: 469 NLFTAVILFSPKAYPVTGKNFNYAPVIFGAITIFGLISWLSIPASRWSTFYDASKLDSNS 528 Query: 328 QEMTGEDE 305 + + D+ Sbjct: 529 FDDSSSDK 536
>K1199_HUMAN (Q8WUJ3) Protein KIAA1199 precursor| Length = 1361 Score = 28.9 bits (63), Expect = 7.3 Identities = 9/31 (29%), Positives = 18/31 (58%) Frame = -1 Query: 473 VCVCGAXQCECFPYHRHVWHVFNLPLHGGNL 381 + V G + +C+PY H+ + F+ GG++ Sbjct: 498 IIVMGEMEDKCYPYRNHICNFFDFDTFGGHI 528
>COBS_METKA (Q8TUT2) Cobalamin synthase (EC 2.-.-.-)| Length = 241 Score = 28.9 bits (63), Expect = 7.3 Identities = 20/54 (37%), Positives = 29/54 (53%), Gaps = 2/54 (3%) Frame = +1 Query: 232 GRWSIQSMAYLIR-SRFCW-PFKDLAARLPRSSLVILSRACVGQPQPSAVSARL 387 G +I SMA L+ + F W PF+ L S +L A VG+P P++ S R+ Sbjct: 109 GGLAIGSMALLLAVASFGWIPFEVLVPIEVFSRFTVLPMAAVGEPAPASYSGRV 162 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 70,545,669 Number of Sequences: 219361 Number of extensions: 1461422 Number of successful extensions: 3056 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3000 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3056 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3246866728 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)