>SMRC1_HUMAN (Q92922) SWI/SNF-related matrix-associated actin-dependent|
           regulator of chromatin subfamily C member 1 (SWI/SNF
           complex 155 kDa subunit) (BRG1-associated factor 155)
          Length = 1105

 Score = 27.7 bits (60), Expect = 7.6
 Identities = 18/47 (38%), Positives = 24/47 (51%), Gaps = 1/47 (2%)
 Frame = -2

Query: 285 EQTVVXGIKHDT-PLK*EQSRLLSLXKKVQSSVQNFRVIPLYKS*LD 148
           E+TV  G K D  P K +QSR + L +   +   N  +IP Y S  D
Sbjct: 413 EETVTAGGKEDEDPAKGDQSRSVDLGEDNVTEQTNHIIIPSYASWFD 459


  Database: uniprot_sprot.fasta
    Posted date:  May 25, 2006  5:36 PM
  Number of letters in database: 80,573,946
  Number of sequences in database:  219,361
  
Lambda     K      H
   0.318    0.135    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 36,481,146
Number of Sequences: 219361
Number of extensions: 506552
Number of successful extensions: 618
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 612
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 618
length of database: 80,573,946
effective HSP length: 81
effective length of database: 62,805,705
effective search space used: 1507336920
frameshift window, decay const: 50,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)