| Clone Name | rbags28c17 |
|---|---|
| Clone Library Name | barley_pub |
>INAR1_MOUSE (P33896) Interferon-alpha/beta receptor alpha chain precursor| (IFN-alpha-REC) Length = 590 Score = 30.8 bits (68), Expect = 2.4 Identities = 22/66 (33%), Positives = 25/66 (37%), Gaps = 7/66 (10%) Frame = +2 Query: 323 CPSIPALERCRLQKTSTPQTTLRCHRFLPHLYLLCWQISSFPSWSF-------LRCHWKK 481 C L R L KTS L C + P + W I+ F LR WK Sbjct: 397 CVQARVLFRALLNKTSNFSEKL-CEKTRPGSFSTIWIITGLGVVFFSVMVLYALRSVWKY 455 Query: 482 LCHACF 499 LCH CF Sbjct: 456 LCHVCF 461
>RHOG_MOUSE (P84096) Rho-related GTP-binding protein RhoG precursor (Sid 10750)| Length = 191 Score = 30.0 bits (66), Expect = 4.1 Identities = 16/49 (32%), Positives = 28/49 (57%), Gaps = 1/49 (2%) Frame = +2 Query: 353 RLQKTSTPQTTLRCHRFLPHLYLLCWQISSFPSWSFLRCHW-KKLCHAC 496 RL+ S PQT +++++C+ I+S PS+ +R W ++CH C Sbjct: 66 RLRTLSYPQT---------NVFVICFSIASPPSYENVRHKWHPEVCHHC 105
>RHOG_HUMAN (P84095) Rho-related GTP-binding protein RhoG precursor| Length = 191 Score = 30.0 bits (66), Expect = 4.1 Identities = 16/49 (32%), Positives = 28/49 (57%), Gaps = 1/49 (2%) Frame = +2 Query: 353 RLQKTSTPQTTLRCHRFLPHLYLLCWQISSFPSWSFLRCHW-KKLCHAC 496 RL+ S PQT +++++C+ I+S PS+ +R W ++CH C Sbjct: 66 RLRTLSYPQT---------NVFVICFSIASPPSYENVRHKWHPEVCHHC 105
>RHOG_CRICR (P84097) Rho-related GTP-binding protein RhoG precursor| Length = 191 Score = 30.0 bits (66), Expect = 4.1 Identities = 16/49 (32%), Positives = 28/49 (57%), Gaps = 1/49 (2%) Frame = +2 Query: 353 RLQKTSTPQTTLRCHRFLPHLYLLCWQISSFPSWSFLRCHW-KKLCHAC 496 RL+ S PQT +++++C+ I+S PS+ +R W ++CH C Sbjct: 66 RLRTLSYPQT---------NVFVICFSIASPPSYENVRHKWHPEVCHHC 105
>DUS8_MOUSE (O09112) Dual specificity protein phosphatase 8 (EC 3.1.3.48) (EC| 3.1.3.16) (Neuronal tyrosine threonine phosphatase 1) Length = 663 Score = 29.3 bits (64), Expect = 7.0 Identities = 16/38 (42%), Positives = 19/38 (50%), Gaps = 1/38 (2%) Frame = +2 Query: 311 FPGACPSIPA-LERCRLQKTSTPQTTLRCHRFLPHLYL 421 FPG C PA L L + P ++ R LPHLYL Sbjct: 133 FPGLCEGKPATLPSMSLSQPCLPVPSVGLTRILPHLYL 170
>TCMO_RUTGR (Q9AR74) Trans-cinnamate 4-monooxygenase (EC 1.14.13.11) (Cinnamic| acid 4-hydroxylase) (CA4H) (C4H) (P450C4H) (Cytochrome P450 73) Length = 506 Score = 29.3 bits (64), Expect = 7.0 Identities = 21/73 (28%), Positives = 29/73 (39%) Frame = +3 Query: 18 FRCQSNHQNKSRCLPTMTLIATRTLQQDFTNRSQPASSVNPTTHQAPLIPSRQSTRTHLR 197 F S H K R + T+ + +QQ N A+ V P +T LR Sbjct: 119 FTVYSEHWRKMRRIMTVPFFTNKVVQQQRFNWEDEAARV---VEDVKKDPQAATTGIVLR 175 Query: 198 RRAQLLKIRRVHR 236 RR QLL ++R Sbjct: 176 RRLQLLMYNNMYR 188
>C27AA_BACUH (Q9S597) Pesticidal crystal protein cry27Aa (Insecticidal| delta-endotoxin CryXXVIIA(a)) (Crystaline entomocidal protoxin) (94 kDa crystal protein) Length = 826 Score = 28.9 bits (63), Expect = 9.1 Identities = 14/37 (37%), Positives = 20/37 (54%) Frame = +3 Query: 30 SNHQNKSRCLPTMTLIATRTLQQDFTNRSQPASSVNP 140 S + + +P T I TRT+ D NR++P S NP Sbjct: 299 STYDPRLYTMPIKTEILTRTIYTDGVNRNEPKSIHNP 335
>Y1463_METTH (Q50500) Hypothetical protein MTH1463 (ORF11)| Length = 142 Score = 28.9 bits (63), Expect = 9.1 Identities = 18/65 (27%), Positives = 29/65 (44%) Frame = -1 Query: 404 GIDDTEVSFAELMFSGDGSVPEPVSKDKPLGTAADGKFFGGLVIDHTKKRKKAKGIPMDA 225 G++ TE AEL GT G GL++ T K +A+G+ M+ Sbjct: 37 GVNCTEAELAELA-----------------GTDESGTTMYGLIVAATSKGLRARGVKMEL 79 Query: 224 SDLKQ 210 +DL++ Sbjct: 80 NDLRK 84 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 72,489,561 Number of Sequences: 219361 Number of extensions: 1519392 Number of successful extensions: 4919 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 4684 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4910 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4027872870 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)