| Clone Name | rbags27m21 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | VG48_SHV21 (Q01033) Hypothetical gene 48 protein | 31 | 1.3 | 2 | FRU_DROME (Q8IN81) Sex determination protein fruitless | 30 | 1.7 | 3 | UNC18_CAEEL (P34815) Putative acetylcholine regulator unc-18 (Un... | 30 | 2.9 | 4 | LARGE_CHICK (Q66PG3) Glycosyltransferase-like protein LARGE1 (EC... | 28 | 8.3 |
|---|
>VG48_SHV21 (Q01033) Hypothetical gene 48 protein| Length = 797 Score = 30.8 bits (68), Expect = 1.3 Identities = 20/52 (38%), Positives = 28/52 (53%), Gaps = 1/52 (1%) Frame = -1 Query: 272 LNLVRHPECLEGLLPLKRDTXESLRDLADVTWTXKELLFAC-CR*QTLSEEG 120 LNL+ EC +GL L R E ++D DV + +E+ + C R L EEG Sbjct: 77 LNLI---ECTQGLKFLIRSLYEKIKDQCDVKSSIREIFYDCKARLLLLLEEG 125
>FRU_DROME (Q8IN81) Sex determination protein fruitless| Length = 955 Score = 30.4 bits (67), Expect = 1.7 Identities = 15/47 (31%), Positives = 23/47 (48%) Frame = +2 Query: 104 CTEKQFPLQIGSVICSRQRGAPWXSTXHLPGHATTPXCPSSVAKAPP 244 C K L + ++ CSRQ+ + H P H + CP+ A +PP Sbjct: 712 CEYKCKELNMRAIRCSRQQHMMSHYSPHHPHHRSLIDCPAEAAYSPP 758
>UNC18_CAEEL (P34815) Putative acetylcholine regulator unc-18 (Uncoordinated| protein 18) Length = 591 Score = 29.6 bits (65), Expect = 2.9 Identities = 16/55 (29%), Positives = 27/55 (49%) Frame = -1 Query: 281 LSLLNLVRHPECLEGLLPLKRDTXESLRDLADVTWTXKELLFACCR*QTLSEEGI 117 +SL +V H + + PLK+ S ++ V +L +CC+ + EEGI Sbjct: 1 MSLKQIVGHKLLNDVIRPLKKGDGRSAWNVLIVDTLAMRMLSSCCKMHNIMEEGI 55
>LARGE_CHICK (Q66PG3) Glycosyltransferase-like protein LARGE1 (EC 2.4.-.-)| (Acetylglucosaminyltransferase-like 1A) Length = 756 Score = 28.1 bits (61), Expect = 8.3 Identities = 18/51 (35%), Positives = 22/51 (43%), Gaps = 3/51 (5%) Frame = +1 Query: 112 EAIPSSDRVCHLQQAKRSSLXVHVTSARSRND---SXVSLFSGKSPSKHSG 255 E+ P S R Q R SL V + N +SL G+SPS H G Sbjct: 46 ESQPHSPRYTASSQRDRESLEVRMREVEEENRVLRKQLSLAQGRSPSHHRG 96 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 54,156,570 Number of Sequences: 219361 Number of extensions: 963648 Number of successful extensions: 2448 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2394 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2448 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2169600302 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)