| Clone Name | rbags27m14 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PRL_CAPHI (Q28318) Prolactin precursor (PRL) | 29 | 10.0 | 2 | ASD4_NEUCR (Q9HEV5) GATA type zinc finger protein Asd4 (Ascus de... | 29 | 10.0 |
|---|
>PRL_CAPHI (Q28318) Prolactin precursor (PRL)| Length = 229 Score = 28.9 bits (63), Expect = 10.0 Identities = 14/55 (25%), Positives = 28/55 (50%) Frame = +3 Query: 21 MVSHWLEHQLSELYSDAESTYRFDRSRTNQILCYCYLSKLRTGITEQLTQKIAYE 185 MVSH++ + SE++++ + Y + L C+ S L T ++ Q+ +E Sbjct: 54 MVSHYIHNLSSEMFNEFDKRYAQGKGYITMALNSCHTSSLPTPEDKEQAQQTHHE 108
>ASD4_NEUCR (Q9HEV5) GATA type zinc finger protein Asd4 (Ascus development| protein 4) Length = 426 Score = 28.9 bits (63), Expect = 10.0 Identities = 14/35 (40%), Positives = 21/35 (60%) Frame = -1 Query: 425 PLNMSDLKQAHEQVCASISSDSTNMNELVQWNELY 321 P+N + Q HEQ+ A+ +S T ++EL ELY Sbjct: 174 PMNGEHMPQTHEQLLAANASLKTRVSELEVIQELY 208 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 68,779,116 Number of Sequences: 219361 Number of extensions: 1193263 Number of successful extensions: 2172 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2135 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2172 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4430660157 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)