| Clone Name | rbags27l09 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | HEM3_LEGPL (Q5WT65) Porphobilinogen deaminase (EC 2.5.1.61) (PBG... | 30 | 2.4 | 2 | HEM3_LEGPA (Q5X1F2) Porphobilinogen deaminase (EC 2.5.1.61) (PBG... | 30 | 2.4 | 3 | GIDB_PORGI (Q7MV10) Methyltransferase gidB (EC 2.1.-.-) (Glucose... | 30 | 2.4 | 4 | HEM3_LEGPH (Q5ZRY6) Porphobilinogen deaminase (EC 2.5.1.61) (PBG... | 29 | 3.1 |
|---|
>HEM3_LEGPL (Q5WT65) Porphobilinogen deaminase (EC 2.5.1.61) (PBG)| (Hydroxymethylbilane synthase) (HMBS) (Pre-uroporphyrinogen synthase) Length = 309 Score = 29.6 bits (65), Expect = 2.4 Identities = 12/27 (44%), Positives = 18/27 (66%) Frame = +1 Query: 49 RGAICIECKTTQMEKALFITGLEIPLT 129 +GA+CIEC+T +E I GL P++ Sbjct: 198 QGALCIECRTDDLEIQELIYGLNDPIS 224
>HEM3_LEGPA (Q5X1F2) Porphobilinogen deaminase (EC 2.5.1.61) (PBG)| (Hydroxymethylbilane synthase) (HMBS) (Pre-uroporphyrinogen synthase) Length = 309 Score = 29.6 bits (65), Expect = 2.4 Identities = 12/27 (44%), Positives = 18/27 (66%) Frame = +1 Query: 49 RGAICIECKTTQMEKALFITGLEIPLT 129 +GA+CIEC+T +E I GL P++ Sbjct: 198 QGALCIECRTDDLEIQELIHGLNDPIS 224
>GIDB_PORGI (Q7MV10) Methyltransferase gidB (EC 2.1.-.-) (Glucose-inhibited| division protein B) Length = 221 Score = 29.6 bits (65), Expect = 2.4 Identities = 18/42 (42%), Positives = 27/42 (64%) Frame = -2 Query: 128 VSGISRPVINNAFSICVVLHSIHIAPLR*FVEGVSLIKLGTG 3 ++ ISR I+N + + VLHS+ IA + F G S++ LGTG Sbjct: 47 INVISRKDIDNLY-LHHVLHSLGIARMLNFKPGTSVLDLGTG 87
>HEM3_LEGPH (Q5ZRY6) Porphobilinogen deaminase (EC 2.5.1.61) (PBG)| (Hydroxymethylbilane synthase) (HMBS) (Pre-uroporphyrinogen synthase) Length = 309 Score = 29.3 bits (64), Expect = 3.1 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = +1 Query: 49 RGAICIECKTTQMEKALFITGLEIPLT 129 +GA+CIEC+T +E + GL P++ Sbjct: 198 QGALCIECRTDDLEIQELVHGLNDPIS 224 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 22,278,359 Number of Sequences: 219361 Number of extensions: 321935 Number of successful extensions: 563 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 560 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 563 length of database: 80,573,946 effective HSP length: 23 effective length of database: 75,528,643 effective search space used: 1812687432 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)