| Clone Name | rbags28a06 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | STCK_EMENI (Q00706) Putative sterigmatocystin biosynthesis fatty... | 30 | 2.1 | 2 | YNK6_YEAST (P50942) Hypothetical 133.3 kDa protein in CYB5-LEU4 ... | 29 | 4.7 | 3 | M3K2_MOUSE (Q61083) Mitogen-activated protein kinase kinase kina... | 28 | 8.1 |
|---|
>STCK_EMENI (Q00706) Putative sterigmatocystin biosynthesis fatty acid synthase| beta subunit Length = 1914 Score = 30.4 bits (67), Expect = 2.1 Identities = 18/57 (31%), Positives = 28/57 (49%), Gaps = 6/57 (10%) Frame = -3 Query: 156 VVAPVDREREGSWTPDFDRLMA---RSIWSIMHYVMSSCCPIV---ILQMCTGNYVL 4 ++ +R R SW P FD L+ R I H+ M+ C +V +L+ TG V+ Sbjct: 1479 IIGDNERTRFCSWAPSFDGLVRANDRLRMEIQHFAMADGCMVVHVRVLKESTGEQVM 1535
>YNK6_YEAST (P50942) Hypothetical 133.3 kDa protein in CYB5-LEU4 intergenic| region Length = 1183 Score = 29.3 bits (64), Expect = 4.7 Identities = 16/46 (34%), Positives = 21/46 (45%) Frame = +1 Query: 61 NIVHNRPNRPCHEAIKIRSPGTLSLSIDRCYNISLDSAFKQGFSSH 198 N P PCHE K+ S G+ S D +L K+GF+ H Sbjct: 154 NAQEQAPKHPCHELRKLLSNGSFYYSTDFDLTCTLQ---KRGFTEH 196
>M3K2_MOUSE (Q61083) Mitogen-activated protein kinase kinase kinase 2 (EC| 2.7.11.25) (MAPK/ERK kinase kinase 2) (MEK kinase 2) (MEKK 2) Length = 619 Score = 28.5 bits (62), Expect = 8.1 Identities = 27/98 (27%), Positives = 42/98 (42%), Gaps = 4/98 (4%) Frame = -3 Query: 366 DMDKGTRLMDKGMHSPKTLTCMVMEPMLVIQTTNNQQLHLSRHRHNSEPSPLGLPDMR*E 187 D+DK L+D+ +H M+ + ++ N S N EPSP D+ Sbjct: 98 DLDKAVELLDRSIH---------MKSLKILLVVNG-----STQATNLEPSP-SPEDLNNT 142 Query: 186 PL-FEGAVEANVVAPVDREREG---SWTPDFDRLMARS 85 PL E +VV P +R+R + PD +AR+ Sbjct: 143 PLGAERKKRLSVVGPPNRDRSSPPPGYIPDILHQIARN 180 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 55,923,246 Number of Sequences: 219361 Number of extensions: 986726 Number of successful extensions: 2234 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2192 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2233 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2735358828 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)