| Clone Name | rbags27l05 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | VCLA_GOSHI (P09799) Vicilin GC72-A precursor (Alpha-globulin A) | 35 | 0.12 | 2 | MST2_DROHY (Q08696) Axoneme-associated protein mst101(2) | 32 | 1.0 | 3 | VCLB_GOSHI (P09801) Vicilin C72 precursor (Alpha-globulin B) | 31 | 2.3 | 4 | VNCS_PAVPN (P18547) Noncapsid protein NS-1 (Nonstructural protei... | 30 | 6.7 | 5 | VCL_THECC (Q43358) Vicilin precursor | 29 | 8.8 |
|---|
>VCLA_GOSHI (P09799) Vicilin GC72-A precursor (Alpha-globulin A)| Length = 605 Score = 35.4 bits (80), Expect = 0.12 Identities = 18/55 (32%), Positives = 26/55 (47%), Gaps = 1/55 (1%) Frame = -2 Query: 587 DQSNDSCDHKCQ-HHKVPARKKQCVDECHRREHHHPSRAACERKCSHWRDPTRKE 426 D+ C +CQ + P RK+QCV EC + P + E K WR+ +E Sbjct: 119 DKQFKECQQRCQWQEQRPERKQQCVKECREQYQEDPWKGERENK---WREEEEEE 170 Score = 30.8 bits (68), Expect = 3.0 Identities = 15/61 (24%), Positives = 32/61 (52%), Gaps = 7/61 (11%) Frame = -2 Query: 569 CDHKCQHHKVPAR---KKQCVDECHRREHHHPSRA--ACERKCSHWRD--PTRKERCVQT 411 C CQ + R ++ C ++ +++ P + C+++C W++ P RK++CV+ Sbjct: 87 CRQHCQQEERRLRPHCEQSCREQYEKQQQQQPDKQFKECQQRCQ-WQEQRPERKQQCVKE 145 Query: 410 C 408 C Sbjct: 146 C 146
>MST2_DROHY (Q08696) Axoneme-associated protein mst101(2)| Length = 1391 Score = 32.3 bits (72), Expect = 1.0 Identities = 13/56 (23%), Positives = 26/56 (46%) Frame = -2 Query: 569 CDHKCQHHKVPARKKQCVDECHRREHHHPSRAACERKCSHWRDPTRKERCVQTCMR 402 C+ + + K A KK+C +E +RE + C ++ T K++C + + Sbjct: 1112 CEERAKKEKEAAEKKRC-EEAAKREKEAAEKKKCAEAAKKEKEATEKQKCAEAAKK 1166 Score = 31.2 bits (69), Expect = 2.3 Identities = 14/56 (25%), Positives = 26/56 (46%) Frame = -2 Query: 569 CDHKCQHHKVPARKKQCVDECHRREHHHPSRAACERKCSHWRDPTRKERCVQTCMR 402 C+ + + K A KKQC +E ++ + CE + ++ K+RC + R Sbjct: 1080 CEERAKKEKEAAEKKQC-EERAKKLKEAAEKKQCEERAKKEKEAAEKKRCEEAAKR 1134 Score = 30.8 bits (68), Expect = 3.0 Identities = 13/56 (23%), Positives = 26/56 (46%) Frame = -2 Query: 569 CDHKCQHHKVPARKKQCVDECHRREHHHPSRAACERKCSHWRDPTRKERCVQTCMR 402 C+ + + K A KKQC +E ++E + CE ++ K++C + + Sbjct: 1096 CEERAKKLKEAAEKKQC-EERAKKEKEAAEKKRCEEAAKREKEAAEKKKCAEAAKK 1150 Score = 29.6 bits (65), Expect = 6.7 Identities = 13/56 (23%), Positives = 25/56 (44%) Frame = -2 Query: 569 CDHKCQHHKVPARKKQCVDECHRREHHHPSRAACERKCSHWRDPTRKERCVQTCMR 402 C+ + K A KK+C +E ++E R CE + + K++C + + Sbjct: 399 CEKAAKERKEAAEKKKC-EEAAKKEKEAAERKKCEELAKNIKKAAEKKKCKEAAKK 453
>VCLB_GOSHI (P09801) Vicilin C72 precursor (Alpha-globulin B)| Length = 588 Score = 31.2 bits (69), Expect = 2.3 Identities = 15/38 (39%), Positives = 19/38 (50%), Gaps = 1/38 (2%) Frame = -2 Query: 569 CDHKC-QHHKVPARKKQCVDECHRREHHHPSRAACERK 459 C C Q + P RK+QCV EC R +P R E + Sbjct: 127 CQQHCHQQEQRPERKQQCVRECRERYQENPWRREREEE 164
>VNCS_PAVPN (P18547) Noncapsid protein NS-1 (Nonstructural protein NS1)| Length = 660 Score = 29.6 bits (65), Expect = 6.7 Identities = 14/39 (35%), Positives = 20/39 (51%) Frame = -3 Query: 565 TTSANIIKFRRGRSSAWTSATDGSIITRAGRLARGSVAI 449 TT A +I +RG ++W ATD + L +G V I Sbjct: 52 TTDAEMINLQRGAETSWDQATDMEWESEIDSLTKGQVLI 90
>VCL_THECC (Q43358) Vicilin precursor| Length = 525 Score = 29.3 bits (64), Expect = 8.8 Identities = 13/65 (20%), Positives = 27/65 (41%), Gaps = 10/65 (15%) Frame = -2 Query: 587 DQSNDSCDHKC----------QHHKVPARKKQCVDECHRREHHHPSRAACERKCSHWRDP 438 ++ + C+ +C Q ++ + +QC C ++ + C+RKC W Sbjct: 56 EREQEQCEQRCEREYKEQQRQQEEELQRQYQQCQGRCQEQQQGQREQQQCQRKC--WEQY 113 Query: 437 TRKER 423 +ER Sbjct: 114 KEQER 118 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 73,438,740 Number of Sequences: 219361 Number of extensions: 1337340 Number of successful extensions: 3872 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 3693 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3864 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 5101629520 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)