| Clone Name | rbags27j24 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | GT2_ARATH (O22775) Putative glycosyltransferase 2 (EC 2.4.-.-) (... | 56 | 5e-08 | 2 | XT1_ARATH (Q9LZJ3) Xyloglucan 6-xylosyltransferase (EC 2.4.2.39)... | 44 | 2e-04 | 3 | PURA_HELHP (Q7VHL2) Adenylosuccinate synthetase (EC 6.3.4.4) (IM... | 29 | 8.2 |
|---|
>GT2_ARATH (O22775) Putative glycosyltransferase 2 (EC 2.4.-.-) (AtGT2)| Length = 461 Score = 56.2 bits (134), Expect = 5e-08 Identities = 24/29 (82%), Positives = 28/29 (96%) Frame = -3 Query: 502 IKRIRNETSNPLDMKDDYGLLHPAFKAVK 416 +KR+RNETSNPL+MKD+ GLLHPAFKAVK Sbjct: 427 VKRVRNETSNPLEMKDELGLLHPAFKAVK 455
>XT1_ARATH (Q9LZJ3) Xyloglucan 6-xylosyltransferase (EC 2.4.2.39) (AtXT1)| Length = 460 Score = 44.3 bits (103), Expect = 2e-04 Identities = 18/29 (62%), Positives = 22/29 (75%) Frame = -3 Query: 502 IKRIRNETSNPLDMKDDYGLLHPAFKAVK 416 +K RN+T PLD KD++GLLHP FKA K Sbjct: 426 VKPTRNQTDRPLDAKDEFGLLHPPFKAAK 454
>PURA_HELHP (Q7VHL2) Adenylosuccinate synthetase (EC 6.3.4.4) (IMP--aspartate| ligase) (AdSS) (AMPSase) Length = 415 Score = 28.9 bits (63), Expect = 8.2 Identities = 15/45 (33%), Positives = 24/45 (53%) Frame = +3 Query: 297 PCYPDSTKKNNYRILIQENLERTNKINVDVVYYSYHVVAVLTALN 431 PCY D +N R++ +NL++ + VD +Y H+ V T N Sbjct: 130 PCYGDKVSRNGVRLMDLKNLDKLRE-KVDSIY--QHIQYVQTLYN 171 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 63,803,149 Number of Sequences: 219361 Number of extensions: 1111432 Number of successful extensions: 2132 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2116 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2132 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3638905326 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)