| Clone Name | rbags27g15 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CX017_HUMAN (Q9NX05) Protein CXorf17 (Tumor antigen BJ-HCC-21) | 28 | 6.2 | 2 | PARC_HAEIN (P43702) DNA topoisomerase 4 subunit A (EC 5.99.1.-) ... | 28 | 8.2 |
|---|
>CX017_HUMAN (Q9NX05) Protein CXorf17 (Tumor antigen BJ-HCC-21)| Length = 1096 Score = 28.1 bits (61), Expect = 6.2 Identities = 16/46 (34%), Positives = 21/46 (45%) Frame = +2 Query: 113 VDLLY*ESSKLRSNNKQHSHRTQKKVSPLWPGHPSYRRGLLHIPVP 250 VDLL + R +QH HR + L PG P RG + + P Sbjct: 21 VDLLKLARTVSRQQQQQHLHRQLPPTAALAPGAPRAARGSVPLQPP 66
>PARC_HAEIN (P43702) DNA topoisomerase 4 subunit A (EC 5.99.1.-) (Topoisomerase| IV subunit A) Length = 747 Score = 27.7 bits (60), Expect = 8.2 Identities = 15/34 (44%), Positives = 19/34 (55%) Frame = +2 Query: 23 YKGMKSLLRVAINTSNSSVQAIETTGRRYQVDLL 124 YK S L A SN +V I++TGR Y +D L Sbjct: 529 YKAGDSYLAHACGKSNQAVVFIDSTGRSYALDPL 562 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 31,544,430 Number of Sequences: 219361 Number of extensions: 489121 Number of successful extensions: 1240 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1228 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1240 length of database: 80,573,946 effective HSP length: 59 effective length of database: 67,631,647 effective search space used: 1623159528 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)