| Clone Name | rbaal1g16 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | NUDH_LEGPL (Q5WSU1) Probable (di)nucleoside polyphosphate hydrol... | 28 | 7.9 | 2 | NUDH_LEGPH (Q5ZRK9) Probable (di)nucleoside polyphosphate hydrol... | 28 | 7.9 | 3 | NUDH_LEGPA (Q5X115) Probable (di)nucleoside polyphosphate hydrol... | 28 | 7.9 | 4 | HIS51_SYNPX (Q7U924) Imidazole glycerol phosphate synthase subun... | 28 | 7.9 |
|---|
>NUDH_LEGPL (Q5WSU1) Probable (di)nucleoside polyphosphate hydrolase (EC| 3.6.1.-) Length = 175 Score = 27.7 bits (60), Expect = 7.9 Identities = 17/54 (31%), Positives = 24/54 (44%) Frame = +2 Query: 2 GLVPHKKNLQMXNAEPYLESGXRLDAYEILSIRRQWPDHTSPLQK*RYHEEPQI 163 GL P + +Q E + E G EIL R+W + P Q R+ EP + Sbjct: 40 GLAPGETAMQAMYRELHEEVGLDKGDVEILGSTRRWLKYRLPKQYLRHGSEPLV 93
>NUDH_LEGPH (Q5ZRK9) Probable (di)nucleoside polyphosphate hydrolase (EC| 3.6.1.-) Length = 175 Score = 27.7 bits (60), Expect = 7.9 Identities = 17/54 (31%), Positives = 24/54 (44%) Frame = +2 Query: 2 GLVPHKKNLQMXNAEPYLESGXRLDAYEILSIRRQWPDHTSPLQK*RYHEEPQI 163 GL P + +Q E + E G EIL R+W + P Q R+ EP + Sbjct: 40 GLAPGETAMQAMYRELHEEVGLDKGDVEILGSTRRWLKYRLPKQYLRHGSEPLV 93
>NUDH_LEGPA (Q5X115) Probable (di)nucleoside polyphosphate hydrolase (EC| 3.6.1.-) Length = 175 Score = 27.7 bits (60), Expect = 7.9 Identities = 17/54 (31%), Positives = 24/54 (44%) Frame = +2 Query: 2 GLVPHKKNLQMXNAEPYLESGXRLDAYEILSIRRQWPDHTSPLQK*RYHEEPQI 163 GL P + +Q E + E G EIL R+W + P Q R+ EP + Sbjct: 40 GLAPGETAMQAMYRELHEEVGLDKGDVEILGSTRRWLKYRLPKQYLRHGSEPLV 93
>HIS51_SYNPX (Q7U924) Imidazole glycerol phosphate synthase subunit hisH1 (EC| 2.4.2.-) (IGP synthase glutamine amidotransferase subunit) (IGP synthase subunit hisH1) (ImGP synthase subunit hisH1) (IGPS subunit hisH1) Length = 210 Score = 27.7 bits (60), Expect = 7.9 Identities = 16/55 (29%), Positives = 25/55 (45%), Gaps = 5/55 (9%) Frame = -3 Query: 161 FVVLHGISIFEAVTYDLAIVVGCSESHT-----HPVSXRTLNMVLHXSFASFSCV 12 F V H + + YD I+ + +H HP +T ++L +F SFS V Sbjct: 156 FNVPHDFTTYSYCNYDAKIISSANVNHIMGVQFHPEKSQTNGLILLDNFLSFSNV 210 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 36,930,199 Number of Sequences: 219361 Number of extensions: 576757 Number of successful extensions: 746 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 742 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 746 length of database: 80,573,946 effective HSP length: 68 effective length of database: 65,657,398 effective search space used: 1575777552 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)