| Clone Name | rbags26p10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | Y277_MYCGE (Q49409) Hypothetical protein MG277 | 30 | 4.5 | 2 | COA1_POVBK (P03088) Coat protein VP1 | 30 | 4.5 | 3 | COA1_POVBA (P14996) Coat protein VP1 | 30 | 4.5 | 4 | PPME1_CRYNE (Q5KBD8) Protein phosphatase methylesterase 1 (EC 3.... | 29 | 5.9 | 5 | COA1_SV40 (P03087) Coat protein VP1 | 29 | 5.9 | 6 | HEMA_IADNY (P04660) Hemagglutinin precursor [Contains: Hemagglut... | 29 | 7.7 | 7 | MRGX1_HUMAN (Q96LB2) Mas-related G-protein coupled receptor memb... | 29 | 7.7 |
|---|
>Y277_MYCGE (Q49409) Hypothetical protein MG277| Length = 970 Score = 29.6 bits (65), Expect = 4.5 Identities = 14/45 (31%), Positives = 22/45 (48%) Frame = -1 Query: 486 DDSDLPAQDLQGSCQDADVSGHGDAVKLDDDGTSASATALLIFWK 352 + +L + D A V G+G K + +GTS+S L+ WK Sbjct: 237 NSKNLSSSDYNTGNGQASVEGNGKFFKQNANGTSSSGNKTLVLWK 281
>COA1_POVBK (P03088) Coat protein VP1| Length = 362 Score = 29.6 bits (65), Expect = 4.5 Identities = 12/20 (60%), Positives = 16/20 (80%) Frame = +1 Query: 181 NVTNTATTGMIDTQILGPFC 240 +VTNTATT ++D Q +GP C Sbjct: 236 HVTNTATTVLLDEQGVGPLC 255
>COA1_POVBA (P14996) Coat protein VP1| Length = 362 Score = 29.6 bits (65), Expect = 4.5 Identities = 12/20 (60%), Positives = 16/20 (80%) Frame = +1 Query: 181 NVTNTATTGMIDTQILGPFC 240 +VTNTATT ++D Q +GP C Sbjct: 236 HVTNTATTVLLDEQGVGPLC 255
>PPME1_CRYNE (Q5KBD8) Protein phosphatase methylesterase 1 (EC 3.1.1.-) (PME-1)| Length = 422 Score = 29.3 bits (64), Expect = 5.9 Identities = 18/54 (33%), Positives = 26/54 (48%) Frame = -1 Query: 483 DSDLPAQDLQGSCQDADVSGHGDAVKLDDDGTSASATALLIFWKPDTDVIVKPP 322 D +L +QG Q +S G L +D + A L+ FW +T V+V PP Sbjct: 349 DRELMVGQMQGKFQLEVMSDVGHY--LHEDNPAGLAATLITFWHRNTRVLVLPP 400
>COA1_SV40 (P03087) Coat protein VP1| Length = 364 Score = 29.3 bits (64), Expect = 5.9 Identities = 11/20 (55%), Positives = 16/20 (80%) Frame = +1 Query: 181 NVTNTATTGMIDTQILGPFC 240 ++TNTATT ++D Q +GP C Sbjct: 238 HITNTATTVLLDEQGVGPLC 257
>HEMA_IADNY (P04660) Hemagglutinin precursor [Contains: Hemagglutinin HA1| chain] (Fragment) Length = 100 Score = 28.9 bits (63), Expect = 7.7 Identities = 14/42 (33%), Positives = 22/42 (52%) Frame = +1 Query: 175 QPNVTNTATTGMIDTQILGPFCPI*GYTTTNLGKIRDGWWDL 300 + NVT T++ +++T+ G FC I G +LG W L Sbjct: 37 ESNVTVTSSVELVETEHTGSFCSINGKQPISLGDCSFAGWIL 78
>MRGX1_HUMAN (Q96LB2) Mas-related G-protein coupled receptor member X1 (Sensory| neuron-specific G-protein coupled receptor 4) Length = 322 Score = 28.9 bits (63), Expect = 7.7 Identities = 20/56 (35%), Positives = 32/56 (57%), Gaps = 2/56 (3%) Frame = -3 Query: 301 LDPTTHLLSYLDSSLCNPISGKRDRV--SEYLSYLWWQCLLRLVGCTSRAILLLLV 140 +DPT +S LD+ L PI+G + + + LS C++ LVG T A++L L+ Sbjct: 1 MDPT---ISTLDTEL-TPINGTEETLCYKQTLSLTVLTCIVSLVGLTGNAVVLWLL 52 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 63,885,165 Number of Sequences: 219361 Number of extensions: 1267654 Number of successful extensions: 3386 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 3300 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3386 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3420806017 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)