| Clone Name | rbags27d21 |
|---|---|
| Clone Library Name | barley_pub |
>AP180_RAT (Q05140) Clathrin coat assembly protein AP180 (Clathrin| coat-associated protein AP180) (91 kDa synaptosomal-associated protein) Length = 915 Score = 30.0 bits (66), Expect = 3.3 Identities = 13/43 (30%), Positives = 22/43 (51%) Frame = -1 Query: 444 GMTARSRSMQWLNRQARRPSSGDWQPGCTPG*RTA*ERPEGTM 316 G T++ +QW + + +WQP TP +A P+GT+ Sbjct: 784 GTTSKKGDLQWNAGEKKLTGGANWQPKVTPATWSAGVPPQGTV 826
>AP180_MOUSE (Q61548) Clathrin coat assembly protein AP180 (Clathrin| coat-associated protein AP180) (91 kDa synaptosomal-associated protein) (Phosphoprotein F1-20) Length = 901 Score = 30.0 bits (66), Expect = 3.3 Identities = 13/43 (30%), Positives = 22/43 (51%) Frame = -1 Query: 444 GMTARSRSMQWLNRQARRPSSGDWQPGCTPG*RTA*ERPEGTM 316 G T++ +QW + + +WQP TP +A P+GT+ Sbjct: 770 GTTSKKGDLQWNAGEKKLTGGANWQPKVTPATWSAGVPPQGTV 812
>PRP45_CANGA (Q6FIT9) Pre-mRNA-splicing factor PRP45 (Pre-mRNA-processing| protein 45) Length = 414 Score = 29.6 bits (65), Expect = 4.4 Identities = 15/57 (26%), Positives = 30/57 (52%) Frame = +2 Query: 71 AKCRRYMEKSRGTLHISRAAPNFFSPSPTLHGLEYA*EHGRRARQCGSGDGEMDDVV 241 AK +R ++ R +I A ++ +P GL++ HG++ GS + ++ D+V Sbjct: 166 AKSKRLTKEERAKWNIPAAVSSWKNPMGYTVGLKHRAAHGKKTGNVGSINNKVSDIV 222
>Y659_PASMU (Q9CMZ1) Hypothetical UPF0192 protein PM0659 precursor| Length = 1905 Score = 28.9 bits (63), Expect = 7.5 Identities = 9/18 (50%), Positives = 14/18 (77%) Frame = +3 Query: 345 YVIPEYTPAANPHWMASL 398 Y++PE+TP +PHW +L Sbjct: 301 YLLPEFTPENHPHWRYNL 318
>CLAT_HUMAN (P28329) Choline O-acetyltransferase (EC 2.3.1.6) (CHOACTase)| (Choline acetylase) (ChAT) Length = 748 Score = 28.5 bits (62), Expect = 9.7 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +3 Query: 324 PLASLRPYVIPEYTPAANPHWMASLPAD 407 P A+ RP +P +TPA P W + A+ Sbjct: 61 PRAATRPPPLPAHTPAHTPEWCGAASAE 88
>TMPSD_HUMAN (Q9BYE2) Transmembrane protease, serine 13 (EC 3.4.21.-) (Mosaic| serine protease) (Membrane-type mosaic serine protease) Length = 581 Score = 28.5 bits (62), Expect = 9.7 Identities = 13/47 (27%), Positives = 21/47 (44%) Frame = +1 Query: 1 HGEILTXIRTCSVAGMASRWGRARKVSKVHGEIKGNATHFKSCSEFL 141 HG+ + TC + G K S E++ N FK C+++L Sbjct: 433 HGQTFSLNETCWITGFGKTRETDDKTSPFLREVQVNLIDFKKCNDYL 479 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 66,811,568 Number of Sequences: 219361 Number of extensions: 1353911 Number of successful extensions: 3910 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 3776 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3905 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3304846491 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)