| Clone Name | rbags26n10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | LCE5A_HUMAN (Q5TCM9) Late cornified envelope protein 5A (Late en... | 30 | 2.6 | 2 | VPP4_MOUSE (Q920R6) Vacuolar proton translocating ATPase 116 kDa... | 28 | 7.6 |
|---|
>LCE5A_HUMAN (Q5TCM9) Late cornified envelope protein 5A (Late envelope protein| 18) (Small proline-rich-like epidermal differentiation complex protein 5A) Length = 118 Score = 30.0 bits (66), Expect = 2.6 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +2 Query: 65 QKSVPEKKCTPTCSPVLTPSC 127 Q+ P KCTP C P TP C Sbjct: 8 QQCQPPPKCTPKCPPKCTPKC 28
>VPP4_MOUSE (Q920R6) Vacuolar proton translocating ATPase 116 kDa subunit a| isoform 4 (V-ATPase 116-kDa isoform a4) (Vacuolar proton translocating ATPase 116 kDa subunit a kidney isoform) Length = 833 Score = 28.5 bits (62), Expect = 7.6 Identities = 15/49 (30%), Positives = 23/49 (46%) Frame = -1 Query: 439 RLISWLGRASLIIFILAFMIFVSAISLGGVGISNMIHKIEQHEYMGFEN 293 RL W G + I F + AI L G+S +H + H ++ F+N Sbjct: 761 RLQGWAGLVGVFIIFAVFAVLTVAILLVMEGLSAFLHALRLH-WVEFQN 808 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 57,361,014 Number of Sequences: 219361 Number of extensions: 1005608 Number of successful extensions: 2532 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2459 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2530 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2570413340 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)