| Clone Name | rbags27a23 |
|---|---|
| Clone Library Name | barley_pub |
>IBP3_MOUSE (P47878) Insulin-like growth factor-binding protein 3 precursor| (IGFBP-3) (IBP-3) (IGF-binding protein 3) Length = 291 Score = 30.0 bits (66), Expect = 1.5 Identities = 16/42 (38%), Positives = 19/42 (45%) Frame = -1 Query: 238 RTTQCITR*SSQCGPKGGSPK*EERMNSYNCACCYFHSCALR 113 R C R SQC P +P E + C CC +CALR Sbjct: 38 RCEPCDARAVSQCAPPPTAPACTELVREPGCGCCL--TCALR 77
>IBP3_BOVIN (P20959) Insulin-like growth factor-binding protein 3 precursor| (IGFBP-3) (IBP-3) (IGF-binding protein 3) Length = 291 Score = 30.0 bits (66), Expect = 1.5 Identities = 16/42 (38%), Positives = 19/42 (45%) Frame = -1 Query: 238 RTTQCITR*SSQCGPKGGSPK*EERMNSYNCACCYFHSCALR 113 R C R +QC P SP E + C CC +CALR Sbjct: 39 RCEPCDARAVAQCAPPPPSPPCAELVREPGCGCCL--TCALR 78
>IBP3_PIG (P16611) Insulin-like growth factor-binding protein 3 precursor| (IGFBP-3) (IBP-3) (IGF-binding protein 3) Length = 293 Score = 29.6 bits (65), Expect = 2.0 Identities = 15/42 (35%), Positives = 19/42 (45%) Frame = -1 Query: 238 RTTQCITR*SSQCGPKGGSPK*EERMNSYNCACCYFHSCALR 113 R C R +QC P +P E + C CC +CALR Sbjct: 39 RCEPCDARALAQCAPPPAAPPCAELVREPGCGCCL--TCALR 78
>BMP7_MOUSE (P23359) Bone morphogenetic protein 7 precursor (BMP-7) (Osteogenic| protein 1) (OP-1) Length = 430 Score = 29.3 bits (64), Expect = 2.6 Identities = 18/45 (40%), Positives = 22/45 (48%), Gaps = 2/45 (4%) Frame = +2 Query: 128 VEITACTIVAIHSFFLFWAPAF--RSALATLSGNALCGSSIYHSR 256 + + + A HSF WAP F RSALA S + SS H R Sbjct: 1 MHVRSLRAAAPHSFVALWAPLFLLRSALADFSLDNEVHSSFIHRR 45
>BMP7_HUMAN (P18075) Bone morphogenetic protein 7 precursor (BMP-7) (Osteogenic| protein 1) (OP-1) (Eptotermin alfa) Length = 431 Score = 29.3 bits (64), Expect = 2.6 Identities = 18/45 (40%), Positives = 22/45 (48%), Gaps = 2/45 (4%) Frame = +2 Query: 128 VEITACTIVAIHSFFLFWAPAF--RSALATLSGNALCGSSIYHSR 256 + + + A HSF WAP F RSALA S + SS H R Sbjct: 1 MHVRSLRAAAPHSFVALWAPLFLLRSALADFSLDNEVHSSFIHRR 45
>IBP3_RAT (P15473) Insulin-like growth factor-binding protein 3 precursor| (IGFBP-3) (IBP-3) (IGF-binding protein 3) Length = 292 Score = 28.9 bits (63), Expect = 3.4 Identities = 15/42 (35%), Positives = 19/42 (45%) Frame = -1 Query: 238 RTTQCITR*SSQCGPKGGSPK*EERMNSYNCACCYFHSCALR 113 R C R +QC P +P E + C CC +CALR Sbjct: 39 RCEPCDARALAQCAPPPTAPACTELVREPGCGCCL--TCALR 78 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 38,011,155 Number of Sequences: 219361 Number of extensions: 670310 Number of successful extensions: 1478 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1463 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1478 length of database: 80,573,946 effective HSP length: 77 effective length of database: 63,683,149 effective search space used: 1528395576 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)