| Clone Name | rbags26g19 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | UTP11_ORYSA (Q8S1Z1) Probable U3 small nucleolar RNA-associated ... | 32 | 1.0 | 2 | EDG6_HUMAN (O95977) Sphingosine 1-phosphate receptor Edg-6 (S1P ... | 30 | 3.1 | 3 | ACSA_CRYPV (Q27549) Acetyl-coenzyme A synthetase (EC 6.2.1.1) (A... | 30 | 4.0 |
|---|
>UTP11_ORYSA (Q8S1Z1) Probable U3 small nucleolar RNA-associated protein 11 (U3| snoRNA-associated protein 11) Length = 229 Score = 31.6 bits (70), Expect = 1.0 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = -1 Query: 419 NSVKQPVYKWRAQRKR 372 N +PVYKWRAQRKR Sbjct: 214 NQTSRPVYKWRAQRKR 229
>EDG6_HUMAN (O95977) Sphingosine 1-phosphate receptor Edg-6 (S1P receptor| Edg-6) (Endothelial differentiation G-protein coupled receptor 6) (Sphingosine 1-phosphate receptor 4) (S1P4) Length = 384 Score = 30.0 bits (66), Expect = 3.1 Identities = 15/34 (44%), Positives = 20/34 (58%) Frame = -2 Query: 319 CPTPHPLLSNIFITFCLVIFADIVPETMYCY*SI 218 C + PL S +I FCLVIFA ++ M Y +I Sbjct: 193 CSSLLPLYSKRYILFCLVIFAGVLATIMGLYGAI 226
>ACSA_CRYPV (Q27549) Acetyl-coenzyme A synthetase (EC 6.2.1.1) (Acetate--CoA| ligase) (Acyl-activating enzyme) Length = 694 Score = 29.6 bits (65), Expect = 4.0 Identities = 13/22 (59%), Positives = 17/22 (77%) Frame = -1 Query: 305 SIAFKYLYNLLPGDICGYCAGD 240 ++ KYL+N+ PGDI G CAGD Sbjct: 322 AVTQKYLFNIHPGDIFG-CAGD 342 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 60,830,098 Number of Sequences: 219361 Number of extensions: 1158853 Number of successful extensions: 2240 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2207 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2240 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3014947676 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)