| Clone Name | rbags26g13 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | RPB1_MOUSE (P08775) DNA-directed RNA polymerase II largest subun... | 28 | 4.5 | 2 | RPB1_HUMAN (P24928) DNA-directed RNA polymerase II largest subun... | 28 | 4.5 | 3 | POLN_SINDO (P27283) Nonstructural polyprotein (Polyprotein nsP12... | 28 | 4.5 |
|---|
>RPB1_MOUSE (P08775) DNA-directed RNA polymerase II largest subunit (EC| 2.7.7.6) (RPB1) Length = 1970 Score = 28.5 bits (62), Expect = 4.5 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = +1 Query: 172 CPFHFAHVLLKKSKFHVRWRLET 240 CP HF H+ L K FHV + ++T Sbjct: 81 CPGHFGHIELAKPVFHVGFLVKT 103
>RPB1_HUMAN (P24928) DNA-directed RNA polymerase II largest subunit (EC| 2.7.7.6) (RPB1) Length = 1970 Score = 28.5 bits (62), Expect = 4.5 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = +1 Query: 172 CPFHFAHVLLKKSKFHVRWRLET 240 CP HF H+ L K FHV + ++T Sbjct: 81 CPGHFGHIELAKPVFHVGFLVKT 103
>POLN_SINDO (P27283) Nonstructural polyprotein (Polyprotein nsP1234) (P1234)| [Contains: P123; P123'; mRNA capping enzyme nsP1 (EC 2.1.1.-) (EC 2.7.7.-) (Nonstructural protein 1); Protease/triphosphatase/NTPase/helicase nsP2 (EC 3.4.22.-) (EC 3.1.3.33) (EC Length = 2514 Score = 28.5 bits (62), Expect = 4.5 Identities = 16/73 (21%), Positives = 31/73 (42%) Frame = -3 Query: 277 TMCIHKKLKCRTRSPISIEHEIWIFSAGHVQNGKDTILLLE*IIFKNNTL*YVCHYETY* 98 ++C H + C TR+ S+ +++I + G + + K Y ++T Sbjct: 134 SLCFHNDVTCNTRAEYSVMQDVYINAPGTIYHQ----------AMKGVRTLYWIGFDTTQ 183 Query: 97 FVFLLVTAKYSAY 59 F+F + Y AY Sbjct: 184 FMFSAMAGSYPAY 196 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 42,767,561 Number of Sequences: 219361 Number of extensions: 759856 Number of successful extensions: 1490 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1472 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1490 length of database: 80,573,946 effective HSP length: 75 effective length of database: 64,121,871 effective search space used: 1538924904 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)