| Clone Name | rbags26e01 |
|---|---|
| Clone Library Name | barley_pub |
>LYRIC_HUMAN (Q86UE4) Protein LYRIC (Lysine-rich CEACAM1 co-isolated protein)| (3D3/lyric) (Metastasis adhesion protein) (Metadherin) (Astrocyte elevated gene-1 protein) (AEG-1) Length = 582 Score = 31.2 bits (69), Expect = 1.5 Identities = 16/39 (41%), Positives = 19/39 (48%) Frame = +1 Query: 172 WGEWSFTKCFSFLSRQEDIPCSAAVSDEDAFRPSIILPT 288 WG W + S L QE IP VSD+D + LPT Sbjct: 401 WGNWVDEERASLLKSQEPIPDDQKVSDDDKEKGEGALPT 439
>PLXB2_HUMAN (O15031) Plexin-B2 precursor (MM1)| Length = 1838 Score = 29.6 bits (65), Expect = 4.4 Identities = 12/37 (32%), Positives = 24/37 (64%) Frame = +1 Query: 142 VLRKKNIYMHWGEWSFTKCFSFLSRQEDIPCSAAVSD 252 +LR+ NI++ ++ F C +S +E++PC + VS+ Sbjct: 597 LLRRGNIFLTSYQYPFYDCRQAMSLEENLPCISCVSN 633
>FAF1_HUMAN (Q9UNN5) FAS-associated factor 1 (Protein FAF1) (hFAF1)| Length = 650 Score = 28.5 bits (62), Expect = 9.9 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = +2 Query: 161 SICIGENGASQSASRFLVGRKTSHAAQRYQ 250 S+C+ E+G S R VGR++S A R Q Sbjct: 248 SMCLAESGLSYPCHRLTVGRRSSPAQTREQ 277
>FAF1_RAT (Q924K2) FAS-associated factor 1 (Protein FAF1)| Length = 649 Score = 28.5 bits (62), Expect = 9.9 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = +2 Query: 161 SICIGENGASQSASRFLVGRKTSHAAQRYQ 250 S+C+ E+G S R VGR+TS R Q Sbjct: 247 SMCLAESGLSYPCHRLTVGRRTSPVQTREQ 276
>FAF1_MOUSE (P54731) FAS-associated factor 1 (Protein FAF1)| Length = 649 Score = 28.5 bits (62), Expect = 9.9 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = +2 Query: 161 SICIGENGASQSASRFLVGRKTSHAAQRYQ 250 S+C+ E+G S R VGR+TS R Q Sbjct: 247 SMCLAESGLSYPCHRLTVGRRTSPVQTREQ 276
>SYC_ENTFA (Q839V5) Cysteinyl-tRNA synthetase (EC 6.1.1.16) (Cysteine--tRNA| ligase) (CysRS) Length = 470 Score = 28.5 bits (62), Expect = 9.9 Identities = 16/50 (32%), Positives = 22/50 (44%), Gaps = 3/50 (6%) Frame = -3 Query: 418 KANHEHVISATTAISRRTGKGQQKKEDNL---FWLIVRAFVVSMSKLWAK 278 K +H+ + S+RTG QQ KED L W + +S W K Sbjct: 153 KLSHQSIDELEVGASQRTGVEQQLKEDPLDFALWKSAKEDEISWDSPWGK 202 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 65,917,391 Number of Sequences: 219361 Number of extensions: 1265592 Number of successful extensions: 3275 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 3213 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3274 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3362826254 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)