| Clone Name | rbags25o06 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | TRDH_SFVKA (Q9Q8X0) Transcript release DNA helicase (EC 3.6.1.-) | 32 | 1.3 | 2 | TRDH_MYXVL (Q9Q8J2) Transcript release DNA helicase (EC 3.6.1.-) | 31 | 3.0 | 3 | Y075_MYCPN (P75042) Putative glycosyl transferase MG060 homolog ... | 30 | 8.7 | 4 | AMYG_HORRE (Q03045) Glucoamylase P precursor (EC 3.2.1.3) (Gluca... | 30 | 8.7 |
|---|
>TRDH_SFVKA (Q9Q8X0) Transcript release DNA helicase (EC 3.6.1.-)| Length = 478 Score = 32.3 bits (72), Expect = 1.3 Identities = 15/53 (28%), Positives = 28/53 (52%) Frame = +2 Query: 263 QKKHTKKSSLHSYPYVHFDTCAHSLHHCTLQVISSSTNKIGLESKG*NSAKEQ 421 ++ + K ++ +P HSL T +++S ST+K+G E +G KE+ Sbjct: 414 RESESVKKTVFLFPNTSIREIKHSLGFFTERIVSISTDKLGFEQEGIEGTKEE 466
>TRDH_MYXVL (Q9Q8J2) Transcript release DNA helicase (EC 3.6.1.-)| Length = 478 Score = 31.2 bits (69), Expect = 3.0 Identities = 14/53 (26%), Positives = 28/53 (52%) Frame = +2 Query: 263 QKKHTKKSSLHSYPYVHFDTCAHSLHHCTLQVISSSTNKIGLESKG*NSAKEQ 421 ++ + K ++ +P HSL T +++S ST+K+G + +G KE+ Sbjct: 414 RESESVKKTVFLFPNTSIREIKHSLGFFTERIVSVSTDKLGFQQEGKEGTKEE 466
>Y075_MYCPN (P75042) Putative glycosyl transferase MG060 homolog (EC 2.-.-.-)| (D09_orf299) Length = 299 Score = 29.6 bits (65), Expect = 8.7 Identities = 15/52 (28%), Positives = 25/52 (48%) Frame = +1 Query: 64 LVCFATVNCLHKTRLQVHSDTTTWYNTTIEISRKQHKSTNPAQFQKEKLDHR 219 LV F C K +L++H+ T W N T E+ ++ +F K L ++ Sbjct: 117 LVVFDYTKCWKKIKLKIHTYPTWWKNMTRELQKQTPFCIPLGKFLKRNLFYK 168
>AMYG_HORRE (Q03045) Glucoamylase P precursor (EC 3.2.1.3) (Glucan| 1,4-alpha-glucosidase) (1,4-alpha-D-glucan glucohydrolase) Length = 616 Score = 29.6 bits (65), Expect = 8.7 Identities = 17/42 (40%), Positives = 25/42 (59%), Gaps = 1/42 (2%) Frame = +1 Query: 526 THAAHVS-SQKKSSTIPSIYLQSRELLAPPTTCSKMIAASIY 648 ++AA ++ SQ+++ PS + SR L PPTTCS IY Sbjct: 450 SYAAFITMSQRRAGQYPSSW-GSRNALPPPTTCSASSTPGIY 490 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 98,895,831 Number of Sequences: 219361 Number of extensions: 2026725 Number of successful extensions: 4852 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4666 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4852 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6598423128 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)