| Clone Name | rbaal1f02 |
|---|---|
| Clone Library Name | barley_pub |
>MDHC_ORYSA (Q7XDC8) Malate dehydrogenase, cytoplasmic (EC 1.1.1.37) (PP37)| Length = 332 Score = 88.6 bits (218), Expect = 4e-18 Identities = 41/43 (95%), Positives = 42/43 (97%) Frame = -1 Query: 339 PVTCSGGDWTIVQGLPIDEFSRKKMDATAQELSEEKALAYSCL 211 PVTCSGG+WTIVQGLPIDEFSRKKMDATAQELSEEK LAYSCL Sbjct: 289 PVTCSGGEWTIVQGLPIDEFSRKKMDATAQELSEEKTLAYSCL 331
>MDHC_MAIZE (Q08062) Malate dehydrogenase, cytoplasmic (EC 1.1.1.37)| Length = 332 Score = 87.0 bits (214), Expect = 1e-17 Identities = 40/44 (90%), Positives = 42/44 (95%) Frame = -1 Query: 339 PVTCSGGDWTIVQGLPIDEFSRKKMDATAQELSEEKALAYSCLE 208 PVTCSGG+W IVQGLPIDEFSRKKMDATAQEL+EEK LAYSCLE Sbjct: 289 PVTCSGGEWKIVQGLPIDEFSRKKMDATAQELTEEKTLAYSCLE 332
>MDHC1_ARATH (P93819) Malate dehydrogenase, cytoplasmic 1 (EC 1.1.1.37)| Length = 332 Score = 76.3 bits (186), Expect = 2e-14 Identities = 35/43 (81%), Positives = 37/43 (86%) Frame = -1 Query: 339 PVTCSGGDWTIVQGLPIDEFSRKKMDATAQELSEEKALAYSCL 211 PVTC GDW+IVQGLPIDE SRKKMD TA+EL EEK LAYSCL Sbjct: 289 PVTCRNGDWSIVQGLPIDEVSRKKMDLTAEELKEEKDLAYSCL 331
>MDHC_MESCR (O24047) Malate dehydrogenase, cytoplasmic (EC 1.1.1.37)| Length = 332 Score = 75.5 bits (184), Expect = 3e-14 Identities = 35/43 (81%), Positives = 37/43 (86%) Frame = -1 Query: 339 PVTCSGGDWTIVQGLPIDEFSRKKMDATAQELSEEKALAYSCL 211 PVTC G+WTIVQGLPID+ SRKKMDATA EL EEK LAYSCL Sbjct: 289 PVTCKNGEWTIVQGLPIDDDSRKKMDATAAELVEEKTLAYSCL 331
>MDHC2_ARATH (P57106) Malate dehydrogenase, cytoplasmic 2 (EC 1.1.1.37)| Length = 332 Score = 74.7 bits (182), Expect = 5e-14 Identities = 34/43 (79%), Positives = 37/43 (86%) Frame = -1 Query: 339 PVTCSGGDWTIVQGLPIDEFSRKKMDATAQELSEEKALAYSCL 211 PVTC G+WTIVQGLPID+ SRKKMD TA+EL EEK LAYSCL Sbjct: 289 PVTCRNGEWTIVQGLPIDDASRKKMDLTAEELKEEKDLAYSCL 331
>MDHC_BETVU (Q9SML8) Malate dehydrogenase, cytoplasmic (EC 1.1.1.37)| Length = 332 Score = 73.2 bits (178), Expect = 2e-13 Identities = 34/43 (79%), Positives = 36/43 (83%) Frame = -1 Query: 339 PVTCSGGDWTIVQGLPIDEFSRKKMDATAQELSEEKALAYSCL 211 PVTC G+W IVQGLPIDE SR+KMDAT EL EEKALAYSCL Sbjct: 289 PVTCKDGEWKIVQGLPIDEVSRQKMDATGAELVEEKALAYSCL 331
>MDHC_MEDSA (O48905) Malate dehydrogenase, cytoplasmic (EC 1.1.1.37)| Length = 332 Score = 71.6 bits (174), Expect = 4e-13 Identities = 32/43 (74%), Positives = 38/43 (88%) Frame = -1 Query: 339 PVTCSGGDWTIVQGLPIDEFSRKKMDATAQELSEEKALAYSCL 211 PVTC+ G+W IVQGL IDEFSRKK+D TA+EL+EEK LA+SCL Sbjct: 289 PVTCANGEWKIVQGLSIDEFSRKKLDLTAEELTEEKNLAHSCL 331
>MDHC_PIG (P11708) Malate dehydrogenase, cytoplasmic (EC 1.1.1.37) (Cytosolic| malate dehydrogenase) Length = 333 Score = 53.9 bits (128), Expect = 1e-07 Identities = 25/43 (58%), Positives = 32/43 (74%) Frame = -1 Query: 339 PVTCSGGDWTIVQGLPIDEFSRKKMDATAQELSEEKALAYSCL 211 PVT W IV+GLPI++FSR+KMD TA+EL+EEK A+ L Sbjct: 288 PVTIKDKTWKIVEGLPINDFSREKMDLTAKELAEEKETAFEFL 330
>MDHC_BOVIN (Q3T145) Malate dehydrogenase, cytoplasmic (EC 1.1.1.37) (Cytosolic| malate dehydrogenase) Length = 333 Score = 53.5 bits (127), Expect = 1e-07 Identities = 24/43 (55%), Positives = 32/43 (74%) Frame = -1 Query: 339 PVTCSGGDWTIVQGLPIDEFSRKKMDATAQELSEEKALAYSCL 211 PVT W +V+GLPI++FSR+KMD TA+EL+EEK A+ L Sbjct: 288 PVTIKDKTWKVVEGLPINDFSREKMDLTAKELAEEKETAFEFL 330
>MDH_MYCPA (P61976) Malate dehydrogenase (EC 1.1.1.37)| Length = 329 Score = 52.8 bits (125), Expect = 2e-07 Identities = 23/36 (63%), Positives = 28/36 (77%) Frame = -1 Query: 339 PVTCSGGDWTIVQGLPIDEFSRKKMDATAQELSEEK 232 PVT GDWTIVQGL IDEFSR ++D T EL++E+ Sbjct: 285 PVTTKDGDWTIVQGLEIDEFSRSRIDKTTAELADER 320
>MDH_ACIAD (Q6F7X1) Malate dehydrogenase (EC 1.1.1.37)| Length = 328 Score = 52.0 bits (123), Expect = 4e-07 Identities = 23/37 (62%), Positives = 29/37 (78%) Frame = -1 Query: 339 PVTCSGGDWTIVQGLPIDEFSRKKMDATAQELSEEKA 229 PVTC G++ V+GL IDEFSR++MD T QEL EE+A Sbjct: 285 PVTCENGEYKRVEGLEIDEFSRERMDKTLQELEEERA 321
>MDHC_RAT (O88989) Malate dehydrogenase, cytoplasmic (EC 1.1.1.37) (Cytosolic| malate dehydrogenase) Length = 333 Score = 50.8 bits (120), Expect = 8e-07 Identities = 23/43 (53%), Positives = 30/43 (69%) Frame = -1 Query: 339 PVTCSGGDWTIVQGLPIDEFSRKKMDATAQELSEEKALAYSCL 211 PV W V+GLPI++FSR+KMD TA+EL+EEK A+ L Sbjct: 288 PVVIKNKTWKFVEGLPINDFSREKMDLTAKELTEEKETAFEFL 330
>MDHC_MOUSE (P14152) Malate dehydrogenase, cytoplasmic (EC 1.1.1.37) (Cytosolic| malate dehydrogenase) Length = 333 Score = 50.8 bits (120), Expect = 8e-07 Identities = 23/43 (53%), Positives = 30/43 (69%) Frame = -1 Query: 339 PVTCSGGDWTIVQGLPIDEFSRKKMDATAQELSEEKALAYSCL 211 PV W V+GLPI++FSR+KMD TA+EL+EEK A+ L Sbjct: 288 PVVIKNKTWKFVEGLPINDFSREKMDLTAKELTEEKETAFEFL 330
>MDHC_FELCA (Q7YRU4) Malate dehydrogenase, cytoplasmic (EC 1.1.1.37) (Cytosolic| malate dehydrogenase) Length = 333 Score = 50.8 bits (120), Expect = 8e-07 Identities = 23/43 (53%), Positives = 31/43 (72%) Frame = -1 Query: 339 PVTCSGGDWTIVQGLPIDEFSRKKMDATAQELSEEKALAYSCL 211 PVT W +V+GL I++FSR+KMD TA+EL+EEK A+ L Sbjct: 288 PVTIKNKTWKVVEGLTINDFSREKMDLTAKELAEEKETAFEFL 330
>MDHC_XENTR (Q6DIY9) Malate dehydrogenase, cytoplasmic (EC 1.1.1.37) (Cytosolic| malate dehydrogenase) Length = 334 Score = 50.8 bits (120), Expect = 8e-07 Identities = 24/43 (55%), Positives = 30/43 (69%) Frame = -1 Query: 339 PVTCSGGDWTIVQGLPIDEFSRKKMDATAQELSEEKALAYSCL 211 P+T W IV+GLPI++FSR+KMD TA+EL EEK A L Sbjct: 289 PLTIKNKTWKIVEGLPINDFSREKMDLTAKELHEEKETALEFL 331
>MDHC_HUMAN (P40925) Malate dehydrogenase, cytoplasmic (EC 1.1.1.37) (Cytosolic| malate dehydrogenase) Length = 333 Score = 50.4 bits (119), Expect = 1e-06 Identities = 23/43 (53%), Positives = 30/43 (69%) Frame = -1 Query: 339 PVTCSGGDWTIVQGLPIDEFSRKKMDATAQELSEEKALAYSCL 211 PV W V+GLPI++FSR+KMD TA+EL+EEK A+ L Sbjct: 288 PVVIKNKTWKFVEGLPINDFSREKMDLTAKELTEEKESAFEFL 330
>MDH_BDEBA (P61973) Malate dehydrogenase (EC 1.1.1.37)| Length = 335 Score = 50.1 bits (118), Expect = 1e-06 Identities = 24/43 (55%), Positives = 31/43 (72%) Frame = -1 Query: 339 PVTCSGGDWTIVQGLPIDEFSRKKMDATAQELSEEKALAYSCL 211 PVTC G++ IV+GL ID FSR+KM+ T +EL+EEK S L Sbjct: 293 PVTCKNGEYEIVKGLEIDAFSREKMNNTLKELNEEKDAVASML 335
>MDH_MYCTU (P0A5J6) Malate dehydrogenase (EC 1.1.1.37)| Length = 329 Score = 49.7 bits (117), Expect = 2e-06 Identities = 21/37 (56%), Positives = 29/37 (78%) Frame = -1 Query: 339 PVTCSGGDWTIVQGLPIDEFSRKKMDATAQELSEEKA 229 PVT GG+WTIV GL IDEFSR ++D + EL++E++ Sbjct: 285 PVTTKGGNWTIVSGLEIDEFSRGRIDKSTAELADERS 321
>MDH_MYCBO (P0A5J7) Malate dehydrogenase (EC 1.1.1.37)| Length = 329 Score = 49.7 bits (117), Expect = 2e-06 Identities = 21/37 (56%), Positives = 29/37 (78%) Frame = -1 Query: 339 PVTCSGGDWTIVQGLPIDEFSRKKMDATAQELSEEKA 229 PVT GG+WTIV GL IDEFSR ++D + EL++E++ Sbjct: 285 PVTTKGGNWTIVSGLEIDEFSRGRIDKSTAELADERS 321
>MDHC_CHICK (Q5ZME2) Malate dehydrogenase, cytoplasmic (EC 1.1.1.37) (Cytosolic| malate dehydrogenase) Length = 334 Score = 48.9 bits (115), Expect = 3e-06 Identities = 23/43 (53%), Positives = 29/43 (67%) Frame = -1 Query: 339 PVTCSGGDWTIVQGLPIDEFSRKKMDATAQELSEEKALAYSCL 211 PV W V+GLPI++FSR+KMD TA+EL+EEK A L Sbjct: 289 PVVIKDKTWKFVEGLPINDFSREKMDLTAKELTEEKETAVEFL 331
>MDHC_XENLA (Q6PAB3) Malate dehydrogenase, cytoplasmic (EC 1.1.1.37) (Cytosolic| malate dehydrogenase) Length = 334 Score = 47.8 bits (112), Expect = 7e-06 Identities = 22/43 (51%), Positives = 30/43 (69%) Frame = -1 Query: 339 PVTCSGGDWTIVQGLPIDEFSRKKMDATAQELSEEKALAYSCL 211 P+T W IV+GL I++FSR+KMD TA+EL +EK A+ L Sbjct: 289 PLTIKNKTWKIVEGLCINDFSREKMDITAKELQDEKETAFEFL 331
>MDH_MYCLE (P50917) Malate dehydrogenase (EC 1.1.1.37)| Length = 329 Score = 47.8 bits (112), Expect = 7e-06 Identities = 20/36 (55%), Positives = 29/36 (80%) Frame = -1 Query: 339 PVTCSGGDWTIVQGLPIDEFSRKKMDATAQELSEEK 232 PVT + GDWTIV+GL ID+FSR ++D + EL++E+ Sbjct: 285 PVTTTDGDWTIVRGLGIDDFSRGRIDKSTAELADER 320
>MDH_THEFY (Q47TT4) Malate dehydrogenase (EC 1.1.1.37)| Length = 330 Score = 46.6 bits (109), Expect = 2e-05 Identities = 20/36 (55%), Positives = 27/36 (75%) Frame = -1 Query: 339 PVTCSGGDWTIVQGLPIDEFSRKKMDATAQELSEEK 232 PV G W IVQGL I+EFSR+++DA+ +EL EE+ Sbjct: 285 PVVSRNGSWEIVQGLEINEFSRERIDASVRELEEER 320
>MDH_DEIRA (Q9RXI8) Malate dehydrogenase (EC 1.1.1.37)| Length = 330 Score = 46.6 bits (109), Expect = 2e-05 Identities = 22/36 (61%), Positives = 26/36 (72%) Frame = -1 Query: 339 PVTCSGGDWTIVQGLPIDEFSRKKMDATAQELSEEK 232 PV G + IVQGL + +FSR KMDATAQEL EE+ Sbjct: 285 PVRVKDGKYEIVQGLDVSDFSRGKMDATAQELEEER 320
>MDH_PSYAR (Q4FQU7) Malate dehydrogenase (EC 1.1.1.37)| Length = 329 Score = 46.6 bits (109), Expect = 2e-05 Identities = 21/37 (56%), Positives = 28/37 (75%), Gaps = 1/37 (2%) Frame = -1 Query: 339 PVTCSGGDWTIVQGLPIDE-FSRKKMDATAQELSEEK 232 P TC+ GDW+IV G+ + FS++KM AT QELSEE+ Sbjct: 285 PCTCTNGDWSIVDGVDVSSAFSKEKMAATEQELSEER 321
>MDH_STRCO (Q9K3J3) Malate dehydrogenase (EC 1.1.1.37)| Length = 329 Score = 45.8 bits (107), Expect = 3e-05 Identities = 21/36 (58%), Positives = 28/36 (77%) Frame = -1 Query: 339 PVTCSGGDWTIVQGLPIDEFSRKKMDATAQELSEEK 232 PVT G + IVQGL I+EFSR ++DA+ +ELSEE+ Sbjct: 285 PVTTKDGSYEIVQGLDINEFSRARIDASVKELSEER 320
>MDH_AZOSE (Q5NYA9) Malate dehydrogenase (EC 1.1.1.37)| Length = 329 Score = 45.4 bits (106), Expect = 3e-05 Identities = 20/44 (45%), Positives = 29/44 (65%) Frame = -1 Query: 339 PVTCSGGDWTIVQGLPIDEFSRKKMDATAQELSEEKALAYSCLE 208 P C GD+ I+QGL IDE+SR+K++ T EL +E+A L+ Sbjct: 286 PCECKNGDFKIIQGLEIDEYSREKINKTLGELEDERAAVADMLK 329
>MDH_CHRVO (Q7NZ60) Malate dehydrogenase (EC 1.1.1.37)| Length = 326 Score = 45.4 bits (106), Expect = 3e-05 Identities = 20/37 (54%), Positives = 26/37 (70%) Frame = -1 Query: 339 PVTCSGGDWTIVQGLPIDEFSRKKMDATAQELSEEKA 229 PV C G++ V+GL ID FSR++MD T EL EE+A Sbjct: 283 PVVCENGEYKRVEGLEIDAFSRERMDLTLAELEEERA 319
>MDH_RALEJ (Q46YU4) Malate dehydrogenase (EC 1.1.1.37)| Length = 327 Score = 45.4 bits (106), Expect = 3e-05 Identities = 20/37 (54%), Positives = 28/37 (75%) Frame = -1 Query: 339 PVTCSGGDWTIVQGLPIDEFSRKKMDATAQELSEEKA 229 PVTC+ G + IV+GL ID +S++K++ T EL EEKA Sbjct: 284 PVTCANGKYEIVKGLEIDAYSQEKINITLNELEEEKA 320
>MDH_PROAC (Q6A6Z5) Malate dehydrogenase (EC 1.1.1.37)| Length = 327 Score = 45.4 bits (106), Expect = 3e-05 Identities = 21/36 (58%), Positives = 29/36 (80%) Frame = -1 Query: 339 PVTCSGGDWTIVQGLPIDEFSRKKMDATAQELSEEK 232 PVT + G IVQGL ID+FSR K+DA+A+EL++E+ Sbjct: 283 PVTITNGKVEIVQGLDIDDFSRAKIDASAKELADER 318
>MDH_BURPS (P80536) Malate dehydrogenase (EC 1.1.1.37)| Length = 326 Score = 44.3 bits (103), Expect = 8e-05 Identities = 20/36 (55%), Positives = 25/36 (69%) Frame = -1 Query: 339 PVTCSGGDWTIVQGLPIDEFSRKKMDATAQELSEEK 232 PV C G++ V+GL ID FSR+KMD T EL EE+ Sbjct: 283 PVICENGEYKRVEGLEIDAFSREKMDGTLAELLEER 318
>MDH_XANAC (Q8PNP8) Malate dehydrogenase (EC 1.1.1.37)| Length = 328 Score = 44.3 bits (103), Expect = 8e-05 Identities = 20/37 (54%), Positives = 27/37 (72%) Frame = -1 Query: 339 PVTCSGGDWTIVQGLPIDEFSRKKMDATAQELSEEKA 229 PVT G +TIV+ LPID+FS+K +D T EL EE++ Sbjct: 285 PVTTENGKYTIVKDLPIDDFSQKYIDKTLAELEEERS 321
>MDH_DECAR (Q47C34) Malate dehydrogenase (EC 1.1.1.37)| Length = 328 Score = 44.3 bits (103), Expect = 8e-05 Identities = 18/35 (51%), Positives = 28/35 (80%) Frame = -1 Query: 339 PVTCSGGDWTIVQGLPIDEFSRKKMDATAQELSEE 235 P C GG ++I+QGL IDE+SR+K++ T +EL++E Sbjct: 286 PCECKGGKFSIIQGLEIDEYSREKINFTLKELTDE 320
>MDH_BURMA (Q62AG8) Malate dehydrogenase (EC 1.1.1.37)| Length = 327 Score = 44.3 bits (103), Expect = 8e-05 Identities = 20/36 (55%), Positives = 25/36 (69%) Frame = -1 Query: 339 PVTCSGGDWTIVQGLPIDEFSRKKMDATAQELSEEK 232 PV C G++ V+GL ID FSR+KMD T EL EE+ Sbjct: 284 PVICENGEYKRVEGLEIDAFSREKMDGTLAELLEER 319
>MDH_NOCFA (Q5YTI1) Malate dehydrogenase (EC 1.1.1.37)| Length = 334 Score = 43.9 bits (102), Expect = 1e-04 Identities = 18/36 (50%), Positives = 28/36 (77%) Frame = -1 Query: 339 PVTCSGGDWTIVQGLPIDEFSRKKMDATAQELSEEK 232 PVTC+ G + IV+GL +D FSR+++DA+ EL+ E+ Sbjct: 288 PVTCADGAYRIVEGLEVDAFSRERIDASVAELTAER 323
>MDH_XANCP (Q8PC25) Malate dehydrogenase (EC 1.1.1.37)| Length = 328 Score = 43.9 bits (102), Expect = 1e-04 Identities = 19/37 (51%), Positives = 27/37 (72%) Frame = -1 Query: 339 PVTCSGGDWTIVQGLPIDEFSRKKMDATAQELSEEKA 229 PVT G +T+V+ LPID+FS+K +D T EL EE++ Sbjct: 285 PVTTENGQYTLVKDLPIDDFSQKYIDKTLAELEEERS 321
>MDH_XANC8 (Q4URH2) Malate dehydrogenase (EC 1.1.1.37)| Length = 328 Score = 43.9 bits (102), Expect = 1e-04 Identities = 19/37 (51%), Positives = 27/37 (72%) Frame = -1 Query: 339 PVTCSGGDWTIVQGLPIDEFSRKKMDATAQELSEEKA 229 PVT G +T+V+ LPID+FS+K +D T EL EE++ Sbjct: 285 PVTTENGQYTLVKDLPIDDFSQKYIDKTLAELEEERS 321
>MDH_STRAW (Q82HS2) Malate dehydrogenase (EC 1.1.1.37)| Length = 329 Score = 43.5 bits (101), Expect = 1e-04 Identities = 20/36 (55%), Positives = 27/36 (75%) Frame = -1 Query: 339 PVTCSGGDWTIVQGLPIDEFSRKKMDATAQELSEEK 232 PVT G + IVQGL I+EFSR ++DA+ +EL EE+ Sbjct: 285 PVTTKDGRYEIVQGLEINEFSRARIDASVKELEEER 320
>MDH_THETH (P10584) Malate dehydrogenase (EC 1.1.1.37)| Length = 327 Score = 43.5 bits (101), Expect = 1e-04 Identities = 19/35 (54%), Positives = 27/35 (77%) Frame = -1 Query: 339 PVTCSGGDWTIVQGLPIDEFSRKKMDATAQELSEE 235 PVT G + +V+GL I+EF+RK+M+ TAQEL +E Sbjct: 283 PVTAKDGAYRVVEGLEINEFARKRMEITAQELLDE 317
>MDH_THET8 (Q5SKV7) Malate dehydrogenase (EC 1.1.1.37)| Length = 327 Score = 43.5 bits (101), Expect = 1e-04 Identities = 19/35 (54%), Positives = 27/35 (77%) Frame = -1 Query: 339 PVTCSGGDWTIVQGLPIDEFSRKKMDATAQELSEE 235 PVT G + +V+GL I+EF+RK+M+ TAQEL +E Sbjct: 283 PVTAKDGAYRVVEGLEINEFARKRMEITAQELLDE 317
>MDH_THET2 (P61977) Malate dehydrogenase (EC 1.1.1.37)| Length = 327 Score = 43.5 bits (101), Expect = 1e-04 Identities = 19/35 (54%), Positives = 27/35 (77%) Frame = -1 Query: 339 PVTCSGGDWTIVQGLPIDEFSRKKMDATAQELSEE 235 PVT G + +V+GL I+EF+RK+M+ TAQEL +E Sbjct: 283 PVTAKDGAYRVVEGLEINEFARKRMEITAQELLDE 317
>MDH_XYLFT (Q87E35) Malate dehydrogenase (EC 1.1.1.37)| Length = 328 Score = 42.4 bits (98), Expect = 3e-04 Identities = 19/37 (51%), Positives = 27/37 (72%) Frame = -1 Query: 339 PVTCSGGDWTIVQGLPIDEFSRKKMDATAQELSEEKA 229 PVT + G+++IV+ LPID FS+ +D T EL EE+A Sbjct: 285 PVTTTNGEYSIVKDLPIDTFSKTYIDKTLAELEEERA 321
>MDH_XYLFA (Q9PE17) Malate dehydrogenase (EC 1.1.1.37)| Length = 328 Score = 42.4 bits (98), Expect = 3e-04 Identities = 19/37 (51%), Positives = 27/37 (72%) Frame = -1 Query: 339 PVTCSGGDWTIVQGLPIDEFSRKKMDATAQELSEEKA 229 PVT + G+++IV+ LPID FS+ +D T EL EE+A Sbjct: 285 PVTTTNGEYSIVKDLPIDTFSKTYIDKTLAELEEERA 321
>MDH_XANOR (Q5H496) Malate dehydrogenase (EC 1.1.1.37)| Length = 328 Score = 42.4 bits (98), Expect = 3e-04 Identities = 18/37 (48%), Positives = 27/37 (72%) Frame = -1 Query: 339 PVTCSGGDWTIVQGLPIDEFSRKKMDATAQELSEEKA 229 PVT G +++V+ LPID+FS+K +D T EL EE++ Sbjct: 285 PVTTENGQYSLVKDLPIDDFSQKYIDKTLAELEEERS 321
>MDH_CORGL (Q8NN33) Malate dehydrogenase (EC 1.1.1.37)| Length = 328 Score = 41.2 bits (95), Expect = 6e-04 Identities = 17/36 (47%), Positives = 23/36 (63%) Frame = -1 Query: 339 PVTCSGGDWTIVQGLPIDEFSRKKMDATAQELSEEK 232 P G+W IV+GL I +F R ++DA AQEL E+ Sbjct: 286 PTVSRNGEWEIVEGLEISDFQRARIDANAQELQAER 321
>MDH_AQUAR (Q9ZF99) Malate dehydrogenase (EC 1.1.1.37)| Length = 328 Score = 40.4 bits (93), Expect = 0.001 Identities = 18/36 (50%), Positives = 26/36 (72%) Frame = -1 Query: 339 PVTCSGGDWTIVQGLPIDEFSRKKMDATAQELSEEK 232 PVT G++ IVQGL ID FS+++++ T EL EE+ Sbjct: 285 PVTTENGEYKIVQGLSIDAFSQERINVTLNELLEEQ 320
>MDH_METCA (Q60B71) Malate dehydrogenase (EC 1.1.1.37)| Length = 325 Score = 40.4 bits (93), Expect = 0.001 Identities = 19/38 (50%), Positives = 26/38 (68%) Frame = -1 Query: 339 PVTCSGGDWTIVQGLPIDEFSRKKMDATAQELSEEKAL 226 PVT G + IVQ LP+D FSR+++ T EL EE+A+ Sbjct: 283 PVTIENGRFRIVQDLPLDTFSRERLRLTEVELLEERAM 320
>MDH_RALSO (Q8XXW5) Malate dehydrogenase (EC 1.1.1.37)| Length = 329 Score = 40.0 bits (92), Expect = 0.001 Identities = 16/37 (43%), Positives = 27/37 (72%) Frame = -1 Query: 339 PVTCSGGDWTIVQGLPIDEFSRKKMDATAQELSEEKA 229 PVT + G + +V+G +D +SR+K++ T +EL EE+A Sbjct: 286 PVTTANGKYEVVKGFEVDAYSREKINITLKELEEERA 322
>MDH_COREF (Q8FN62) Malate dehydrogenase (EC 1.1.1.37)| Length = 323 Score = 38.1 bits (87), Expect = 0.005 Identities = 14/36 (38%), Positives = 23/36 (63%) Frame = -1 Query: 339 PVTCSGGDWTIVQGLPIDEFSRKKMDATAQELSEEK 232 P G+W +V+GL I++F R ++DA +EL E+ Sbjct: 281 PTVSRNGEWEVVEGLEINDFQRARIDANVEELQGER 316
>MDH_DESPS (Q6AQI3) Malate dehydrogenase (EC 1.1.1.37)| Length = 325 Score = 37.7 bits (86), Expect = 0.007 Identities = 16/36 (44%), Positives = 20/36 (55%) Frame = -1 Query: 339 PVTCSGGDWTIVQGLPIDEFSRKKMDATAQELSEEK 232 PV C GDW V GL + F R ++AT EL E+ Sbjct: 283 PVICEDGDWREVAGLELSSFQRAMLEATEAELQAER 318
>MDH_CORJK (Q4JWV0) Malate dehydrogenase (EC 1.1.1.37)| Length = 330 Score = 37.4 bits (85), Expect = 0.009 Identities = 17/37 (45%), Positives = 23/37 (62%) Frame = -1 Query: 339 PVTCSGGDWTIVQGLPIDEFSRKKMDATAQELSEEKA 229 P G+W IVQGL I ++++DA +EL EEKA Sbjct: 286 PCRSVDGEWEIVQGLEISPAQQERIDANIKELQEEKA 322
>MDH_NITEU (Q82WB9) Malate dehydrogenase (EC 1.1.1.37)| Length = 327 Score = 37.0 bits (84), Expect = 0.012 Identities = 17/35 (48%), Positives = 21/35 (60%) Frame = -1 Query: 339 PVTCSGGDWTIVQGLPIDEFSRKKMDATAQELSEE 235 PV C G IVQGL I FSR ++D EL++E Sbjct: 284 PVVCKNGGRKIVQGLEISPFSRTRLDIAYDELTQE 318
>MDH_BORPE (Q7VW97) Malate dehydrogenase (EC 1.1.1.37)| Length = 329 Score = 36.6 bits (83), Expect = 0.016 Identities = 15/36 (41%), Positives = 25/36 (69%) Frame = -1 Query: 339 PVTCSGGDWTIVQGLPIDEFSRKKMDATAQELSEEK 232 PV G++ +++ L ID FSR+++D T +EL EE+ Sbjct: 286 PVVTENGEYKMIKDLEIDAFSRERLDFTLKELLEER 321
>MDH_BORPA (Q7W5Q8) Malate dehydrogenase (EC 1.1.1.37)| Length = 329 Score = 36.6 bits (83), Expect = 0.016 Identities = 15/36 (41%), Positives = 25/36 (69%) Frame = -1 Query: 339 PVTCSGGDWTIVQGLPIDEFSRKKMDATAQELSEEK 232 PV G++ +++ L ID FSR+++D T +EL EE+ Sbjct: 286 PVVTENGEYKMIKDLEIDAFSRERLDFTLKELLEER 321
>MDH_BORBR (Q7WD94) Malate dehydrogenase (EC 1.1.1.37)| Length = 329 Score = 36.6 bits (83), Expect = 0.016 Identities = 15/36 (41%), Positives = 25/36 (69%) Frame = -1 Query: 339 PVTCSGGDWTIVQGLPIDEFSRKKMDATAQELSEEK 232 PV G++ +++ L ID FSR+++D T +EL EE+ Sbjct: 286 PVVTENGEYKMIKDLEIDAFSRERLDFTLKELLEER 321
>MDHC_ECHGR (Q04820) Malate dehydrogenase, cytoplasmic (EC 1.1.1.37)| Length = 332 Score = 35.8 bits (81), Expect = 0.027 Identities = 16/39 (41%), Positives = 25/39 (64%) Frame = -1 Query: 339 PVTCSGGDWTIVQGLPIDEFSRKKMDATAQELSEEKALA 223 PVT G + +V GL +DE+SR + +A EL +E+ +A Sbjct: 289 PVTIKDGHYKVVDGLSMDEWSRSLFNLSADELVDEREVA 327
>MDH_CHLCV (Q822E9) Malate dehydrogenase (EC 1.1.1.37)| Length = 330 Score = 34.3 bits (77), Expect = 0.079 Identities = 15/31 (48%), Positives = 21/31 (67%) Frame = -1 Query: 321 GDWTIVQGLPIDEFSRKKMDATAQELSEEKA 229 GD+ IV GLP D F + K+ + E+S+EKA Sbjct: 295 GDYEIVPGLPWDAFIKNKIQISLDEISQEKA 325
>MDH_CHLMU (Q9PK18) Malate dehydrogenase (EC 1.1.1.37)| Length = 326 Score = 32.3 bits (72), Expect = 0.30 Identities = 15/31 (48%), Positives = 20/31 (64%) Frame = -1 Query: 321 GDWTIVQGLPIDEFSRKKMDATAQELSEEKA 229 G++ IV GLP D F R KM + E+ +EKA Sbjct: 292 GEYEIVPGLPWDAFIRGKMQISLDEILQEKA 322
>MDH_PARUW (Q6MAA3) Malate dehydrogenase (EC 1.1.1.37)| Length = 330 Score = 32.3 bits (72), Expect = 0.30 Identities = 16/38 (42%), Positives = 23/38 (60%) Frame = -1 Query: 321 GDWTIVQGLPIDEFSRKKMDATAQELSEEKALAYSCLE 208 G+ +IV GL D F +K+ T QEL EE+ + S L+ Sbjct: 292 GELSIVSGLKWDAFLEEKIKLTEQELKEEREMVSSILK 329
>MDH_CHLPN (Q9Z6N1) Malate dehydrogenase (EC 1.1.1.37)| Length = 328 Score = 32.3 bits (72), Expect = 0.30 Identities = 13/31 (41%), Positives = 21/31 (67%) Frame = -1 Query: 321 GDWTIVQGLPIDEFSRKKMDATAQELSEEKA 229 GD+ I+ GLP + F R K+ + E+++EKA Sbjct: 293 GDYEIIPGLPWEPFIRNKIQISLDEIAQEKA 323
>MDH_CHLAB (Q5L5E3) Malate dehydrogenase (EC 1.1.1.37)| Length = 330 Score = 30.4 bits (67), Expect = 1.1 Identities = 14/31 (45%), Positives = 20/31 (64%) Frame = -1 Query: 321 GDWTIVQGLPIDEFSRKKMDATAQELSEEKA 229 GD+ IV GL D F + K+ + E+S+EKA Sbjct: 295 GDYEIVPGLLWDTFIKNKIQISLDEISQEKA 325
>Y818_BARHE (Q6G3F5) UPF0078 membrane protein BH08180| Length = 211 Score = 30.0 bits (66), Expect = 1.5 Identities = 12/24 (50%), Positives = 18/24 (75%) Frame = +1 Query: 46 SGKRGATSLIHTGNQRKGACTVLC 117 SG GAT+++ TGN++ A T+LC Sbjct: 45 SGNIGATNVLRTGNKKVAALTLLC 68
>MDH_CORDI (P61974) Malate dehydrogenase (EC 1.1.1.37)| Length = 326 Score = 28.5 bits (62), Expect = 4.3 Identities = 12/36 (33%), Positives = 17/36 (47%) Frame = -1 Query: 339 PVTCSGGDWTIVQGLPIDEFSRKKMDATAQELSEEK 232 P G W IVQ L + +F + + EL EE+ Sbjct: 283 PTISEDGQWKIVQDLELSDFQKDGIARNVTELEEER 318
>Y640_BARQU (Q6FZS3) UPF0078 membrane protein BQ06400| Length = 211 Score = 28.5 bits (62), Expect = 4.3 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = +1 Query: 46 SGKRGATSLIHTGNQRKGACTVLC 117 SG GAT+++ TGN++ T+LC Sbjct: 45 SGNIGATNVLRTGNKKVATLTLLC 68
>MTH2_HAEHA (P00473) Modification methylase HhaII (EC 2.1.1.72)| (Adenine-specific methyltransferase HhaII) (M.HhaII) Length = 228 Score = 27.7 bits (60), Expect = 7.4 Identities = 19/57 (33%), Positives = 26/57 (45%) Frame = +3 Query: 30 NLPQMFR*KGSYKPHTHWKPAKRSMHRAVQLFWVDTGVESGRFLLFKTSEHQLLFEC 200 N+P ++ K KPHTH KP + QL T + G +L S +FEC Sbjct: 155 NIPDVWAEKLQSKPHTHSKPIEMQK----QLILATT--QEGDLILDPASGGYSVFEC 205
>CR14_HORVU (P26154) Cold-regulated protein BLT14| Length = 88 Score = 27.7 bits (60), Expect = 7.4 Identities = 11/33 (33%), Positives = 15/33 (45%) Frame = +1 Query: 58 GATSLIHTGNQRKGACTVLCSCSGWTRELKAEG 156 GA + G +R+G C C W R L+ G Sbjct: 14 GARVMRRAGREREGCSDTRCRCQRWRRRLQGFG 46
>CP2DH_MACFA (Q29488) Cytochrome P450 2D17 (EC 1.14.14.1) (CYPIID17)| Length = 497 Score = 27.3 bits (59), Expect = 9.7 Identities = 11/35 (31%), Positives = 17/35 (48%) Frame = -1 Query: 159 ETFRFQLPCPPRTAAQHGACSFSLVSSVYEACSSP 55 + F F +P + HG +F + S YE C+ P Sbjct: 462 QRFSFSVPAGQPRPSHHGVFAFLVTPSPYELCAVP 496
>Y3058_BORPA (Q7W669) UPF0078 membrane protein BPP3058| Length = 215 Score = 27.3 bits (59), Expect = 9.7 Identities = 13/30 (43%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Frame = +1 Query: 46 SGKRGATSLIHTGNQRKGACTVL-CSCSGW 132 SG GAT+++ TGN+ A T+L + GW Sbjct: 48 SGNPGATNVLRTGNKTAAALTLLGDAAKGW 77
>Y3021_BORBR (Q7WI35) UPF0078 membrane protein BB3021| Length = 215 Score = 27.3 bits (59), Expect = 9.7 Identities = 13/30 (43%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Frame = +1 Query: 46 SGKRGATSLIHTGNQRKGACTVL-CSCSGW 132 SG GAT+++ TGN+ A T+L + GW Sbjct: 48 SGNPGATNVLRTGNKTAAALTLLGDAAKGW 77
>Y1718_BORPE (Q7VXN3) UPF0078 membrane protein BP1718| Length = 215 Score = 27.3 bits (59), Expect = 9.7 Identities = 13/30 (43%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Frame = +1 Query: 46 SGKRGATSLIHTGNQRKGACTVL-CSCSGW 132 SG GAT+++ TGN+ A T+L + GW Sbjct: 48 SGNPGATNVLRTGNKTAAALTLLGDAAKGW 77 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 44,873,709 Number of Sequences: 219361 Number of extensions: 796410 Number of successful extensions: 2445 Number of sequences better than 10.0: 70 Number of HSP's better than 10.0 without gapping: 2396 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2444 length of database: 80,573,946 effective HSP length: 88 effective length of database: 61,270,178 effective search space used: 1470484272 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)