| Clone Name | rbags25n13 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | Y1792_ARCFU (O28482) Hypothetical protein AF1792 | 30 | 5.4 | 2 | SM50_STRPU (P11994) 50 kDa spicule matrix protein precursor | 30 | 5.4 | 3 | BMP15_SHEEP (Q9MZE2) Bone morphogenetic protein 15 precursor (BM... | 29 | 9.2 |
|---|
>Y1792_ARCFU (O28482) Hypothetical protein AF1792| Length = 137 Score = 30.0 bits (66), Expect = 5.4 Identities = 20/57 (35%), Positives = 27/57 (47%) Frame = -1 Query: 324 EGFDRRNSNPVTIGALCASALIG*TVYHTENGQCVAAVVETKCRLVLLVLIYGYYEF 154 E RR +IGA + A++ HTE +A C LVL ++ YGYY F Sbjct: 79 ERASRRTVEIFSIGAALSGAVMLALDLHTE--AALALEFAVCCVLVLYLIFYGYYSF 133
>SM50_STRPU (P11994) 50 kDa spicule matrix protein precursor| Length = 445 Score = 30.0 bits (66), Expect = 5.4 Identities = 10/22 (45%), Positives = 17/22 (77%) Frame = +3 Query: 345 SAYNSSPSNSPKINHPPTSNWP 410 +A++SSP++ P+ PPT +WP Sbjct: 119 AAFSSSPASPPRPGMPPTRSWP 140
>BMP15_SHEEP (Q9MZE2) Bone morphogenetic protein 15 precursor (BMP-15)| (Growth/differentiation factor 9B) (GDF-9B) Length = 393 Score = 29.3 bits (64), Expect = 9.2 Identities = 21/64 (32%), Positives = 30/64 (46%), Gaps = 7/64 (10%) Frame = -3 Query: 190 SVARAHLWLL*I*FEEQLACCQIGPRSILHL-------LMLQCLRFAVGNSRLYPRFVRK 32 S+ R LW L + E ++ Q+G SI HL L+ + L A G + PR + Sbjct: 5 SILRILLWGLVLFMEHRVQMTQVGQPSIAHLPEAPTLPLIQELLEEAPGKQQRKPRVLGH 64 Query: 31 LLRY 20 LRY Sbjct: 65 PLRY 68 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 87,106,303 Number of Sequences: 219361 Number of extensions: 1745261 Number of successful extensions: 4218 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4069 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4215 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5310515667 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)