| Clone Name | rbags25m22 |
|---|---|
| Clone Library Name | barley_pub |
>NIPB_DROME (Q7PLI2) Nipped-B protein (SCC2 homolog)| Length = 2077 Score = 29.6 bits (65), Expect = 7.6 Identities = 16/50 (32%), Positives = 23/50 (46%) Frame = -3 Query: 539 LSARLLKDKLPASTFKVLTEYHATTVKLLALQDAATGDEDDCTSDRMLEK 390 L A+ D +P + +L Y V L A T DED+ D ++EK Sbjct: 547 LKAKQALDSIPKNKLTLLINYAMRNVYLARNYFAGTEDEDEFVDDEVIEK 596
>VGLY_TACV7 (P31842) Glycoprotein polyprotein [Contains: Glycoprotein G1;| Glycoprotein G2] Length = 482 Score = 29.3 bits (64), Expect = 9.9 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +1 Query: 265 IDLCTYTRAWRTMHALFAAHSLP 333 + C YTR W H L HSLP Sbjct: 350 VPYCNYTRFWYVNHTLSGQHSLP 372
>VGLY_TACVT (P31840) Glycoprotein polyprotein [Contains: Glycoprotein G1;| Glycoprotein G2] Length = 483 Score = 29.3 bits (64), Expect = 9.9 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +1 Query: 265 IDLCTYTRAWRTMHALFAAHSLP 333 + C YTR W H L HSLP Sbjct: 351 VPYCNYTRFWYVNHTLSGQHSLP 373
>VGLY_TACV5 (P31841) Glycoprotein polyprotein [Contains: Glycoprotein G1;| Glycoprotein G2] Length = 483 Score = 29.3 bits (64), Expect = 9.9 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +1 Query: 265 IDLCTYTRAWRTMHALFAAHSLP 333 + C YTR W H L HSLP Sbjct: 351 VPYCNYTRFWYVNHTLSGQHSLP 373
>AIOL_HUMAN (Q9UKT9) Zinc finger protein Aiolos| Length = 509 Score = 29.3 bits (64), Expect = 9.9 Identities = 19/68 (27%), Positives = 33/68 (48%), Gaps = 2/68 (2%) Frame = -3 Query: 521 KDKLPASTFKVLTEYHATTVKLLALQDAATG--DEDDCTSDRMLEKKEDLEERLMPELKS 348 + +PA + VL +Y T + D+ G +ED+ D ++ K++ ER LKS Sbjct: 15 EQSVPAESAAVLNDYSLTKSHEMENVDSGEGPANEDEDIGDDSMKVKDEYSERDENVLKS 74 Query: 347 LALGTGKE 324 +G +E Sbjct: 75 EPMGNAEE 82
>VGLY_TACV (P18141) Glycoprotein polyprotein [Contains: Glycoprotein G1;| Glycoprotein G2] Length = 495 Score = 29.3 bits (64), Expect = 9.9 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +1 Query: 265 IDLCTYTRAWRTMHALFAAHSLP 333 + C YTR W H L HSLP Sbjct: 363 VPYCNYTRFWYVNHTLSGQHSLP 385 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 87,742,310 Number of Sequences: 219361 Number of extensions: 1782561 Number of successful extensions: 5011 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 4851 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5011 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5710231900 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)