| Clone Name | rbags25m16 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | TRPV1_RAT (O35433) Transient receptor potential cation channel s... | 32 | 0.36 | 2 | CYOC_BUCAP (Q8K995) Cytochrome o ubiquinol oxidase subunit 3 (EC... | 30 | 1.4 | 3 | Y862_ARCFU (O29399) UPF0027 protein AF0862 | 28 | 5.1 |
|---|
>TRPV1_RAT (O35433) Transient receptor potential cation channel subfamily V| member 1 (TrpV1) (osm-9-like TRP channel 1) (OTRPC1) (Vanilloid receptor 1) (Vanilloid receptor type 1-like) (Capsaicin receptor) Length = 838 Score = 32.3 bits (72), Expect = 0.36 Identities = 13/43 (30%), Positives = 28/43 (65%), Gaps = 1/43 (2%) Frame = -3 Query: 146 YLFFFLLHIFGKSRILVLDVSD-RRDTVPTVKTPYACQVSSCR 21 ++F +L+ +FG S +V + D + +++P TP+ C+ S+C+ Sbjct: 580 FMFVYLVFLFGFSTAVVTLIEDGKNNSLPMESTPHKCRGSACK 622
>CYOC_BUCAP (Q8K995) Cytochrome o ubiquinol oxidase subunit 3 (EC 1.10.3.-)| (Cytochrome o ubiquinol oxidase subunit III) Length = 189 Score = 30.4 bits (67), Expect = 1.4 Identities = 18/46 (39%), Positives = 25/46 (54%), Gaps = 6/46 (13%) Frame = -1 Query: 178 FXMXTCI---QLFXIYSFF---FCTFLVNHVFWCLMYLIVETLCLL 59 + M CI LF +Y+ F T L+NH + L Y+ +ETL LL Sbjct: 17 YLMSDCIIFAVLFAVYAIISSNFSTNLINHKIFNLSYVFLETLILL 62
>Y862_ARCFU (O29399) UPF0027 protein AF0862| Length = 482 Score = 28.5 bits (62), Expect = 5.1 Identities = 15/54 (27%), Positives = 26/54 (48%) Frame = +2 Query: 20 TYKMIPGRHTESLQ*AQCLYDQIHQAPKYVIYQKCAKEKRIDXKQLNTCXHXKG 181 T++ + G + L + +YD H K+ +E R+D K++ C H KG Sbjct: 308 TFQKVMGMSEDDLG-MELVYDVAHNIAKF-------EEHRVDGKKMKLCVHRKG 353 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 23,631,050 Number of Sequences: 219361 Number of extensions: 341171 Number of successful extensions: 928 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 925 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 928 length of database: 80,573,946 effective HSP length: 36 effective length of database: 72,676,950 effective search space used: 1744246800 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)